Anti ADA pAb (ATL-HPA001399 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001399-25

• 
• 
• 

Protein Description: adenosine deaminase
Gene Name: ADA
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000017697: 85%, ENSRNOG00000010265: 83%
Entrez Gene ID: 100
Uniprot ID: P00813
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEE
• Gene Sequence: GDETIPGSSLLPGHVQAYQEAVKSGIHRTVHAGEVGSAEVVKEAVDILKTERLGHGYHTLEDQALYNRLRQENMHFEICPWSSYLTGAWKPDTEHAVIRLKNDQANYSLNTDDPLIFKSTLDTDYQMTKRDMGFTEEE
• Gene ID - Mouse: ENSMUSG00000017697
• Gene ID - Rat: ENSRNOG00000010265
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ADA pAb (ATL-HPA001399 w/enhanced validation) – 2 Found

Bachmann, Julie; Burté, Florence; Pramana, Setia; Conte, Ianina; Brown, Biobele J; Orimadegun, Adebola E; Ajetunmobi, Wasiu A; Afolabi, Nathaniel K; Akinkunmi, Francis; Omokhodion, Samuel; Akinbami, Felix O; Shokunbi, Wuraola A; Kampf, Caroline; Pawitan, Yudi; Uhlén, Mathias; Sodeinde, Olugbemiro; Schwenk, Jochen M; Wahlgren, Mats; Fernandez-Reyes, Delmiro; Nilsson, Peter. Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. Plos Pathogens. 2014;10(4):e1004038. 

Bai, Aiping; Moss, Alan; Kokkotou, Efi; Usheva, Anny; Sun, Xiaofeng; Cheifetz, Adam; Zheng, Yi; Longhi, Maria Serena; Gao, Wenda; Wu, Yan; Robson, Simon C. CD39 and CD161 modulate Th17 responses in Crohn's disease. Journal Of Immunology (Baltimore, Md. : 1950). 2014;193(7):3366-77.