Anti ACY1 pAb (ATL-HPA036175)

Atlas Antibodies

SKU:
ATL-HPA036175-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic and nuclear positivity in subsets of renal tubules.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: aminoacylase 1
Gene Name: ACY1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023262: 83%, ENSRNOG00000011189: 81%
Entrez Gene ID: 95
Uniprot ID: Q03154
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCK
Gene Sequence SVTSVNLTKLEGGVAYNVIPATMSASFDFRVAPDVDFKAFEEQLQSWCQAAGEGVTLEFAQKWMHPQVTPTDDSNPWWAAFSRVCK
Gene ID - Mouse ENSMUSG00000023262
Gene ID - Rat ENSRNOG00000011189
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACY1 pAb (ATL-HPA036175)
Datasheet Anti ACY1 pAb (ATL-HPA036175) Datasheet (External Link)
Vendor Page Anti ACY1 pAb (ATL-HPA036175) at Atlas Antibodies

Documents & Links for Anti ACY1 pAb (ATL-HPA036175)
Datasheet Anti ACY1 pAb (ATL-HPA036175) Datasheet (External Link)
Vendor Page Anti ACY1 pAb (ATL-HPA036175)