Anti ACY1 pAb (ATL-HPA036174)

Atlas Antibodies

SKU:
ATL-HPA036174-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in renal tubules.
  • Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: aminoacylase 1
Gene Name: ACY1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000023262: 87%, ENSRNOG00000011189: 91%
Entrez Gene ID: 95
Uniprot ID: Q03154
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFRE
Gene Sequence QGMELFVQRPEFHALRAGFALDEGIANPTDAFTVFYSERSPWWVRVTSTGRPGHASRFMEDTAAEKLHKVVNSILAFRE
Gene ID - Mouse ENSMUSG00000023262
Gene ID - Rat ENSRNOG00000011189
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACY1 pAb (ATL-HPA036174)
Datasheet Anti ACY1 pAb (ATL-HPA036174) Datasheet (External Link)
Vendor Page Anti ACY1 pAb (ATL-HPA036174) at Atlas Antibodies

Documents & Links for Anti ACY1 pAb (ATL-HPA036174)
Datasheet Anti ACY1 pAb (ATL-HPA036174) Datasheet (External Link)
Vendor Page Anti ACY1 pAb (ATL-HPA036174)