Anti ACVRL1 pAb (ATL-HPA007041)

Atlas Antibodies

Catalog No.:
ATL-HPA007041-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: activin A receptor type II-like 1
Gene Name: ACVRL1
Alternative Gene Name: ACVRLK1, ALK1, HHT, HHT2, ORW2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000530: 69%, ENSRNOG00000028713: 73%
Entrez Gene ID: 94
Uniprot ID: P37023
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL
Gene Sequence DPVKPSRGPLVTCTCESPHCKGPTCRGAWCTVVLVREEGRHPQEHRGCGNLHRELCRGRPTEFVNHYCCDSHLCNHNVSLVLEATQPPSEQPGTDGQL
Gene ID - Mouse ENSMUSG00000000530
Gene ID - Rat ENSRNOG00000028713
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACVRL1 pAb (ATL-HPA007041)
Datasheet Anti ACVRL1 pAb (ATL-HPA007041) Datasheet (External Link)
Vendor Page Anti ACVRL1 pAb (ATL-HPA007041) at Atlas Antibodies

Documents & Links for Anti ACVRL1 pAb (ATL-HPA007041)
Datasheet Anti ACVRL1 pAb (ATL-HPA007041) Datasheet (External Link)
Vendor Page Anti ACVRL1 pAb (ATL-HPA007041)
Citations for Anti ACVRL1 pAb (ATL-HPA007041) – 4 Found
Adams, Stephanie L; Benayoun, Laurent; Tilton, Kathy; Mellott, Tiffany J; Seshadri, Sudha; Blusztajn, Jan Krzysztof; Delalle, Ivana. Immunohistochemical Analysis of Activin Receptor-Like Kinase 1 (ACVRL1/ALK1) Expression in the Rat and Human Hippocampus: Decline in CA3 During Progression of Alzheimer's Disease. Journal Of Alzheimer's Disease : Jad. 63(4):1433-1443.  PubMed
Cunha, Sara I; Pardali, Evangelia; Thorikay, Midory; Anderberg, Charlotte; Hawinkels, Lukas; Goumans, Marie-José; Seehra, Jasbir; Heldin, Carl-Henrik; ten Dijke, Peter; Pietras, Kristian. Genetic and pharmacological targeting of activin receptor-like kinase 1 impairs tumor growth and angiogenesis. The Journal Of Experimental Medicine. 2010;207(1):85-100.  PubMed
Toyonaga, Takahiko; Steinbach, Erin C; Keith, Benjamin P; Barrow, Jasmine B; Schaner, Matthew R; Wolber, Elisabeth A; Beasley, Caroline; Huling, Jennifer; Wang, Yuli; Allbritton, Nancy L; Chaumont, Nicole; Sadiq, Timothy S; Koruda, Mark J; Jain, Animesh; Long, Millie D; Barnes, Edward L; Herfarth, Hans H; Isaacs, Kim L; Hansen, Jonathan J; Shanahan, Michael T; Rahbar, Reza; Furey, Terrence S; Sethupathy, Praveen; Sheikh, Shehzad Z. Decreased Colonic Activin Receptor-Like Kinase 1 Disrupts Epithelial Barrier Integrity in Patients With Crohn's Disease. Cellular And Molecular Gastroenterology And Hepatology. 10(4):779-796.  PubMed
Anderson, Kelley E; Bellio, Thomas A; Aniskovich, Emily; Adams, Stephanie L; Blusztajn, Jan Krzysztof; Delalle, Ivana. The Expression of Activin Receptor-Like Kinase 1 (ACVRL1/ALK1) in Hippocampal Arterioles Declines During Progression of Alzheimer's Disease. Cerebral Cortex Communications. 1(1):tgaa031.  PubMed