Anti ACVR2A pAb (ATL-HPA046997)

Atlas Antibodies

Catalog No.:
ATL-HPA046997-25
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: activin A receptor, type IIA
Gene Name: ACVR2A
Alternative Gene Name: ACTRII, ACVR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052155: 100%, ENSRNOG00000005334: 100%
Entrez Gene ID: 92
Uniprot ID: P27037
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYN
Gene Sequence CEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPYYN
Gene ID - Mouse ENSMUSG00000052155
Gene ID - Rat ENSRNOG00000005334
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACVR2A pAb (ATL-HPA046997)
Datasheet Anti ACVR2A pAb (ATL-HPA046997) Datasheet (External Link)
Vendor Page Anti ACVR2A pAb (ATL-HPA046997) at Atlas Antibodies

Documents & Links for Anti ACVR2A pAb (ATL-HPA046997)
Datasheet Anti ACVR2A pAb (ATL-HPA046997) Datasheet (External Link)
Vendor Page Anti ACVR2A pAb (ATL-HPA046997)