Anti ACVR1C pAb (ATL-HPA007982)

Atlas Antibodies

SKU: ATL-HPA007982-25

• 

Protein Description: activin A receptor, type IC
Gene Name: ACVR1C
Alternative Gene Name: ACVRLK7, ALK7
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026834: 96%, ENSRNOG00000004828: 96%
Entrez Gene ID: 130399
Uniprot ID: Q8NER5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHL
• Gene Sequence: ELSPGLKCVCLLCDSSNFTCQTEGACWASVMLTNGKEQVIKSCVSLPELNAQVFCHSSNNVTKTECCFTDFCNNITLHL
• Gene ID - Mouse: ENSMUSG00000026834
• Gene ID - Rat: ENSRNOG00000004828
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.