Anti ACVR1B pAb (ATL-HPA063761)

Atlas Antibodies

SKU: ATL-HPA063761-100

• 
• 
• 

Protein Description: activin A receptor, type IB
Gene Name: ACVR1B
Alternative Gene Name: ActRIB, ACVRLK4, ALK4, SKR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000532: 94%, ENSRNOG00000006934: 96%
Entrez Gene ID: 91
Uniprot ID: P36896
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVEL
• Gene Sequence: GVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVEL
• Gene ID - Mouse: ENSMUSG00000000532
• Gene ID - Rat: ENSRNOG00000006934
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.