Anti ACVR1B pAb (ATL-HPA063761)

Atlas Antibodies

Catalog No.:
ATL-HPA063761-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: activin A receptor, type IB
Gene Name: ACVR1B
Alternative Gene Name: ActRIB, ACVRLK4, ALK4, SKR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000532: 94%, ENSRNOG00000006934: 96%
Entrez Gene ID: 91
Uniprot ID: P36896
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVEL
Gene Sequence GVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVEL
Gene ID - Mouse ENSMUSG00000000532
Gene ID - Rat ENSRNOG00000006934
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACVR1B pAb (ATL-HPA063761)
Datasheet Anti ACVR1B pAb (ATL-HPA063761) Datasheet (External Link)
Vendor Page Anti ACVR1B pAb (ATL-HPA063761) at Atlas Antibodies

Documents & Links for Anti ACVR1B pAb (ATL-HPA063761)
Datasheet Anti ACVR1B pAb (ATL-HPA063761) Datasheet (External Link)
Vendor Page Anti ACVR1B pAb (ATL-HPA063761)