Anti ACVR1B pAb (ATL-HPA063761)
Atlas Antibodies
- Catalog No.:
- ATL-HPA063761-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: ACVR1B
Alternative Gene Name: ActRIB, ACVRLK4, ALK4, SKR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000532: 94%, ENSRNOG00000006934: 96%
Entrez Gene ID: 91
Uniprot ID: P36896
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVEL |
| Gene Sequence | GVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVEL |
| Gene ID - Mouse | ENSMUSG00000000532 |
| Gene ID - Rat | ENSRNOG00000006934 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACVR1B pAb (ATL-HPA063761) | |
| Datasheet | Anti ACVR1B pAb (ATL-HPA063761) Datasheet (External Link) |
| Vendor Page | Anti ACVR1B pAb (ATL-HPA063761) at Atlas Antibodies |
| Documents & Links for Anti ACVR1B pAb (ATL-HPA063761) | |
| Datasheet | Anti ACVR1B pAb (ATL-HPA063761) Datasheet (External Link) |
| Vendor Page | Anti ACVR1B pAb (ATL-HPA063761) |