Anti ACVR1 pAb (ATL-HPA007505)

Atlas Antibodies

Catalog No.: ATL-HPA007505-25

Protein Description: activin A receptor, type I
Gene Name: ACVR1
Alternative Gene Name: ACVR1A, ACVRLK2, ALK2, SKR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026836: 98%, ENSRNOG00000005033: 98%
Entrez Gene ID: 90
Uniprot ID: Q04771
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLE
• Gene Sequence: RRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLE
• Gene ID - Mouse: ENSMUSG00000026836
• Gene ID - Rat: ENSRNOG00000005033
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.