Anti ACVR1 pAb (ATL-HPA007505)

Atlas Antibodies

Catalog No.:
ATL-HPA007505-25
Shipping:
Calculated at Checkout
$423.00
Adding to cart… The item has been added
Protein Description: activin A receptor, type I
Gene Name: ACVR1
Alternative Gene Name: ACVR1A, ACVRLK2, ALK2, SKR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026836: 98%, ENSRNOG00000005033: 98%
Entrez Gene ID: 90
Uniprot ID: Q04771
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen RRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLE
Gene Sequence RRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLE
Gene ID - Mouse ENSMUSG00000026836
Gene ID - Rat ENSRNOG00000005033
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACVR1 pAb (ATL-HPA007505)
Datasheet Anti ACVR1 pAb (ATL-HPA007505) Datasheet (External Link)
Vendor Page Anti ACVR1 pAb (ATL-HPA007505) at Atlas Antibodies

Documents & Links for Anti ACVR1 pAb (ATL-HPA007505)
Datasheet Anti ACVR1 pAb (ATL-HPA007505) Datasheet (External Link)
Vendor Page Anti ACVR1 pAb (ATL-HPA007505)