Anti ACVR1 pAb (ATL-HPA007505)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007505-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ACVR1
Alternative Gene Name: ACVR1A, ACVRLK2, ALK2, SKR1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026836: 98%, ENSRNOG00000005033: 98%
Entrez Gene ID: 90
Uniprot ID: Q04771
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLE |
| Gene Sequence | RRNQERLNPRDVEYGTIEGLITTNVGDSTLADLLDHSCTSGSGSGLPFLVQRTVARQITLLE |
| Gene ID - Mouse | ENSMUSG00000026836 |
| Gene ID - Rat | ENSRNOG00000005033 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACVR1 pAb (ATL-HPA007505) | |
| Datasheet | Anti ACVR1 pAb (ATL-HPA007505) Datasheet (External Link) |
| Vendor Page | Anti ACVR1 pAb (ATL-HPA007505) at Atlas Antibodies |
| Documents & Links for Anti ACVR1 pAb (ATL-HPA007505) | |
| Datasheet | Anti ACVR1 pAb (ATL-HPA007505) Datasheet (External Link) |
| Vendor Page | Anti ACVR1 pAb (ATL-HPA007505) |