Anti ACTRT3 pAb (ATL-HPA035818)

Atlas Antibodies

Catalog No.:
ATL-HPA035818-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: actin-related protein T3
Gene Name: ACTRT3
Alternative Gene Name: ARPM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037737: 75%, ENSRNOG00000027908: 75%
Entrez Gene ID: 84517
Uniprot ID: Q9BYD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QGGLELCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMF
Gene Sequence QGGLELCVGDQAQDWRSSLFISYPVERGLITSWEDMEIMWKHIYDYNLKLKPCDGPVLITEPALNPLANRQQITEMF
Gene ID - Mouse ENSMUSG00000037737
Gene ID - Rat ENSRNOG00000027908
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACTRT3 pAb (ATL-HPA035818)
Datasheet Anti ACTRT3 pAb (ATL-HPA035818) Datasheet (External Link)
Vendor Page Anti ACTRT3 pAb (ATL-HPA035818) at Atlas Antibodies

Documents & Links for Anti ACTRT3 pAb (ATL-HPA035818)
Datasheet Anti ACTRT3 pAb (ATL-HPA035818) Datasheet (External Link)
Vendor Page Anti ACTRT3 pAb (ATL-HPA035818)