Anti ACTRT3 pAb (ATL-HPA035817)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035817-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ACTRT3
Alternative Gene Name: ARPM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037737: 66%, ENSRNOG00000027908: 65%
Entrez Gene ID: 84517
Uniprot ID: Q9BYD9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | NYLMVLMKNHGIMLLSASDRKIVEDIKESFCYVAMNYEEEMAKKPDCLEKVYQLPDGKVIQLHDQLFSCPEALFSPCHMNLEAPGIDKICFSS |
Gene Sequence | NYLMVLMKNHGIMLLSASDRKIVEDIKESFCYVAMNYEEEMAKKPDCLEKVYQLPDGKVIQLHDQLFSCPEALFSPCHMNLEAPGIDKICFSS |
Gene ID - Mouse | ENSMUSG00000037737 |
Gene ID - Rat | ENSRNOG00000027908 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACTRT3 pAb (ATL-HPA035817) | |
Datasheet | Anti ACTRT3 pAb (ATL-HPA035817) Datasheet (External Link) |
Vendor Page | Anti ACTRT3 pAb (ATL-HPA035817) at Atlas Antibodies |
Documents & Links for Anti ACTRT3 pAb (ATL-HPA035817) | |
Datasheet | Anti ACTRT3 pAb (ATL-HPA035817) Datasheet (External Link) |
Vendor Page | Anti ACTRT3 pAb (ATL-HPA035817) |