Anti ACTR8 pAb (ATL-HPA065236)
Atlas Antibodies
- Catalog No.:
- ATL-HPA065236-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ACTR8
Alternative Gene Name: INO80N
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015971: 96%, ENSRNOG00000015280: 96%
Entrez Gene ID: 93973
Uniprot ID: Q9H981
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YLEIPLKDLKYYRCILLIPDIYNKQHVKELVNMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSHRNTRLCL |
Gene Sequence | YLEIPLKDLKYYRCILLIPDIYNKQHVKELVNMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSHRNTRLCL |
Gene ID - Mouse | ENSMUSG00000015971 |
Gene ID - Rat | ENSRNOG00000015280 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACTR8 pAb (ATL-HPA065236) | |
Datasheet | Anti ACTR8 pAb (ATL-HPA065236) Datasheet (External Link) |
Vendor Page | Anti ACTR8 pAb (ATL-HPA065236) at Atlas Antibodies |
Documents & Links for Anti ACTR8 pAb (ATL-HPA065236) | |
Datasheet | Anti ACTR8 pAb (ATL-HPA065236) Datasheet (External Link) |
Vendor Page | Anti ACTR8 pAb (ATL-HPA065236) |