Anti ACTR8 pAb (ATL-HPA065236)

Atlas Antibodies

Catalog No.:
ATL-HPA065236-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ARP8 actin-related protein 8 homolog (yeast)
Gene Name: ACTR8
Alternative Gene Name: INO80N
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015971: 96%, ENSRNOG00000015280: 96%
Entrez Gene ID: 93973
Uniprot ID: Q9H981
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YLEIPLKDLKYYRCILLIPDIYNKQHVKELVNMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSHRNTRLCL
Gene Sequence YLEIPLKDLKYYRCILLIPDIYNKQHVKELVNMILMKMGFSGIVVHQESVCATYGSGLSSTCIVDVGDQKTSVCCVEDGVSHRNTRLCL
Gene ID - Mouse ENSMUSG00000015971
Gene ID - Rat ENSRNOG00000015280
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACTR8 pAb (ATL-HPA065236)
Datasheet Anti ACTR8 pAb (ATL-HPA065236) Datasheet (External Link)
Vendor Page Anti ACTR8 pAb (ATL-HPA065236) at Atlas Antibodies

Documents & Links for Anti ACTR8 pAb (ATL-HPA065236)
Datasheet Anti ACTR8 pAb (ATL-HPA065236) Datasheet (External Link)
Vendor Page Anti ACTR8 pAb (ATL-HPA065236)