Anti ACTR6 pAb (ATL-HPA038588)

Atlas Antibodies

SKU: ATL-HPA038588-25

• 

Protein Description: ARP6 actin-related protein 6 homolog (yeast)
Gene Name: ACTR6
Alternative Gene Name: ARP6, FLJ13433
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019948: 100%, ENSRNOG00000007875: 100%
Entrez Gene ID: 64431
Uniprot ID: Q9GZN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NAGALSAHRYFRDNPSELCCIIVDSGYSFTHIVPYCRSKKKKEAIIRINVGGKLLTNHLKEIISYRQLHVMDETHVINQVKEDVCYV
• Gene Sequence: NAGALSAHRYFRDNPSELCCIIVDSGYSFTHIVPYCRSKKKKEAIIRINVGGKLLTNHLKEIISYRQLHVMDETHVINQVKEDVCYV
• Gene ID - Mouse: ENSMUSG00000019948
• Gene ID - Rat: ENSRNOG00000007875
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.