Anti ACTR6 pAb (ATL-HPA038587)

Atlas Antibodies

SKU:
ATL-HPA038587-25
  • Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: ARP6 actin-related protein 6 homolog (yeast)
Gene Name: ACTR6
Alternative Gene Name: ARP6, FLJ13433
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019948: 98%, ENSRNOG00000007875: 99%
Entrez Gene ID: 64431
Uniprot ID: Q9GZN1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen FYRDMDIAKLKGEENTVMIDYVLPDFSTIKKGFCKPREEMVLSGKYKSGEQILRLANERFAVPEILFNPSDIGIQEMGIPEAIV
Gene Sequence FYRDMDIAKLKGEENTVMIDYVLPDFSTIKKGFCKPREEMVLSGKYKSGEQILRLANERFAVPEILFNPSDIGIQEMGIPEAIV
Gene ID - Mouse ENSMUSG00000019948
Gene ID - Rat ENSRNOG00000007875
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACTR6 pAb (ATL-HPA038587)
Datasheet Anti ACTR6 pAb (ATL-HPA038587) Datasheet (External Link)
Vendor Page Anti ACTR6 pAb (ATL-HPA038587) at Atlas Antibodies

Documents & Links for Anti ACTR6 pAb (ATL-HPA038587)
Datasheet Anti ACTR6 pAb (ATL-HPA038587) Datasheet (External Link)
Vendor Page Anti ACTR6 pAb (ATL-HPA038587)