Anti ACTR5 pAb (ATL-HPA042676)

Atlas Antibodies

Catalog No.:
ATL-HPA042676-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: ARP5 actin-related protein 5 homolog (yeast)
Gene Name: ACTR5
Alternative Gene Name: Arp5, FLJ12785, INO80M
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037761: 93%, ENSRNOG00000023989: 93%
Entrez Gene ID: 79913
Uniprot ID: Q9H9F9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen GLIISSGYQCTHVLPILEGRLDAKNCKRINLGGSQAAGYLQRLLQLKYPGHLAAITLSRMEEILHEHSYIAEDYVEELHKWRCPDYYENNVHKMQLPFSSKLL
Gene Sequence GLIISSGYQCTHVLPILEGRLDAKNCKRINLGGSQAAGYLQRLLQLKYPGHLAAITLSRMEEILHEHSYIAEDYVEELHKWRCPDYYENNVHKMQLPFSSKLL
Gene ID - Mouse ENSMUSG00000037761
Gene ID - Rat ENSRNOG00000023989
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACTR5 pAb (ATL-HPA042676)
Datasheet Anti ACTR5 pAb (ATL-HPA042676) Datasheet (External Link)
Vendor Page Anti ACTR5 pAb (ATL-HPA042676) at Atlas Antibodies

Documents & Links for Anti ACTR5 pAb (ATL-HPA042676)
Datasheet Anti ACTR5 pAb (ATL-HPA042676) Datasheet (External Link)
Vendor Page Anti ACTR5 pAb (ATL-HPA042676)