Anti ACTR3 pAb (ATL-HPA051683)

Atlas Antibodies

Catalog No.:
ATL-HPA051683-100
Shipping:
Calculated at Checkout
$593.00
Adding to cart… The item has been added
Protein Description: ARP3 actin-related protein 3 homolog (yeast)
Gene Name: ACTR3
Alternative Gene Name: ARP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026341: 100%, ENSRNOG00000003206: 100%
Entrez Gene ID: 10096
Uniprot ID: P61158
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDH
Gene Sequence KPTYATKWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDH
Gene ID - Mouse ENSMUSG00000026341
Gene ID - Rat ENSRNOG00000003206
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACTR3 pAb (ATL-HPA051683)
Datasheet Anti ACTR3 pAb (ATL-HPA051683) Datasheet (External Link)
Vendor Page Anti ACTR3 pAb (ATL-HPA051683) at Atlas Antibodies

Documents & Links for Anti ACTR3 pAb (ATL-HPA051683)
Datasheet Anti ACTR3 pAb (ATL-HPA051683) Datasheet (External Link)
Vendor Page Anti ACTR3 pAb (ATL-HPA051683)