Anti ACTR3 pAb (ATL-HPA047016)
Atlas Antibodies
- Catalog No.:
- ATL-HPA047016-25
- Shipping:
- Calculated at Checkout
$395.00
Gene Name: ACTR3
Alternative Gene Name: ARP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026341: 100%, ENSRNOG00000003206: 100%
Entrez Gene ID: 10096
Uniprot ID: P61158
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGR |
Gene Sequence | VLSGGSTMFRDFGRRLQRDLKRTVDARLKLSEELSGGR |
Gene ID - Mouse | ENSMUSG00000026341 |
Gene ID - Rat | ENSRNOG00000003206 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACTR3 pAb (ATL-HPA047016) | |
Datasheet | Anti ACTR3 pAb (ATL-HPA047016) Datasheet (External Link) |
Vendor Page | Anti ACTR3 pAb (ATL-HPA047016) at Atlas Antibodies |
Documents & Links for Anti ACTR3 pAb (ATL-HPA047016) | |
Datasheet | Anti ACTR3 pAb (ATL-HPA047016) Datasheet (External Link) |
Vendor Page | Anti ACTR3 pAb (ATL-HPA047016) |