Anti ACTR10 pAb (ATL-HPA071251)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071251-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ACTR10
Alternative Gene Name: ACTR11, Arp10, Arp11, HARP11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021076: 94%, ENSRNOG00000007504: 94%
Entrez Gene ID: 55860
Uniprot ID: Q9NZ32
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KALGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMK |
Gene Sequence | KALGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMK |
Gene ID - Mouse | ENSMUSG00000021076 |
Gene ID - Rat | ENSRNOG00000007504 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACTR10 pAb (ATL-HPA071251) | |
Datasheet | Anti ACTR10 pAb (ATL-HPA071251) Datasheet (External Link) |
Vendor Page | Anti ACTR10 pAb (ATL-HPA071251) at Atlas Antibodies |
Documents & Links for Anti ACTR10 pAb (ATL-HPA071251) | |
Datasheet | Anti ACTR10 pAb (ATL-HPA071251) Datasheet (External Link) |
Vendor Page | Anti ACTR10 pAb (ATL-HPA071251) |