Anti ACTR10 pAb (ATL-HPA071251)

Atlas Antibodies

Catalog No.:
ATL-HPA071251-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: actin-related protein 10 homolog (S. cerevisiae)
Gene Name: ACTR10
Alternative Gene Name: ACTR11, Arp10, Arp11, HARP11
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021076: 94%, ENSRNOG00000007504: 94%
Entrez Gene ID: 55860
Uniprot ID: Q9NZ32
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KALGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMK
Gene Sequence KALGTKTFRIHTPPAKANCVAWLGGAIFGALQDILGSRSVSKEYYNQTGRIPDWCSLNNPPLEMMFDVGKTQPPLMK
Gene ID - Mouse ENSMUSG00000021076
Gene ID - Rat ENSRNOG00000007504
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACTR10 pAb (ATL-HPA071251)
Datasheet Anti ACTR10 pAb (ATL-HPA071251) Datasheet (External Link)
Vendor Page Anti ACTR10 pAb (ATL-HPA071251) at Atlas Antibodies

Documents & Links for Anti ACTR10 pAb (ATL-HPA071251)
Datasheet Anti ACTR10 pAb (ATL-HPA071251) Datasheet (External Link)
Vendor Page Anti ACTR10 pAb (ATL-HPA071251)