Anti ACTN2 pAb (ATL-HPA008315 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA008315-25
- Shipping:
- Calculated at Checkout
$423.00
Gene Name: ACTN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052374: 97%, ENSRNOG00000017833: 97%
Entrez Gene ID: 88
Uniprot ID: P35609
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | AHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGD |
| Gene Sequence | AHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGD |
| Gene ID - Mouse | ENSMUSG00000052374 |
| Gene ID - Rat | ENSRNOG00000017833 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACTN2 pAb (ATL-HPA008315 w/enhanced validation) | |
| Datasheet | Anti ACTN2 pAb (ATL-HPA008315 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACTN2 pAb (ATL-HPA008315 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACTN2 pAb (ATL-HPA008315 w/enhanced validation) | |
| Datasheet | Anti ACTN2 pAb (ATL-HPA008315 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACTN2 pAb (ATL-HPA008315 w/enhanced validation) |
| Citations for Anti ACTN2 pAb (ATL-HPA008315 w/enhanced validation) – 3 Found |
| Schneider, Oliver; Zeifang, Lisa; Fuchs, Stefanie; Sailer, Carla; Loskill, Peter. User-Friendly and Parallelized Generation of Human Induced Pluripotent Stem Cell-Derived Microtissues in a Centrifugal Heart-on-a-Chip. Tissue Engineering. Part A. 2019;25(9-10):786-798. PubMed |
| de Groot, N E; van den Hoogenhof, M M G; Najafi, A; van der Made, I; van der Velden, J; Beqqali, A; Pinto, Y M; Creemers, E E. Heterozygous loss of Rbm24 in the adult mouse heart increases sarcomere slack length but does not affect function. Scientific Reports. 2020;10(1):7687. PubMed |
| Gladka, Monika M; Kohela, Arwa; Molenaar, Bas; Versteeg, Danielle; Kooijman, Lieneke; Monshouwer-Kloots, Jantine; Kremer, Veerle; Vos, Harmjan R; Huibers, Manon M H; Haigh, Jody J; Huylebroeck, Danny; Boon, Reinier A; Giacca, Mauro; van Rooij, Eva. Cardiomyocytes stimulate angiogenesis after ischemic injury in a ZEB2-dependent manner. Nature Communications. 2021;12(1):84. PubMed |