Anti ACTN2 pAb (ATL-HPA008315 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA008315-25

• 

Protein Description: actinin, alpha 2
Gene Name: ACTN2
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052374: 97%, ENSRNOG00000017833: 97%
Entrez Gene ID: 88
Uniprot ID: P35609
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGD
• Gene Sequence: AHEQFKATLPEADGERQSIMAIQNEVEKVIQSYNIRISSSNPYSTVTMDELRTKWDKVKQLVPIRDQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGD
• Gene ID - Mouse: ENSMUSG00000052374
• Gene ID - Rat: ENSRNOG00000017833
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ACTN2 pAb (ATL-HPA008315 w/enhanced validation) – 3 Found

Schneider, Oliver; Zeifang, Lisa; Fuchs, Stefanie; Sailer, Carla; Loskill, Peter. User-Friendly and Parallelized Generation of Human Induced Pluripotent Stem Cell-Derived Microtissues in a Centrifugal Heart-on-a-Chip. Tissue Engineering. Part A. 2019;25(9-10):786-798. 

de Groot, N E; van den Hoogenhof, M M G; Najafi, A; van der Made, I; van der Velden, J; Beqqali, A; Pinto, Y M; Creemers, E E. Heterozygous loss of Rbm24 in the adult mouse heart increases sarcomere slack length but does not affect function. Scientific Reports. 2020;10(1):7687. 

Gladka, Monika M; Kohela, Arwa; Molenaar, Bas; Versteeg, Danielle; Kooijman, Lieneke; Monshouwer-Kloots, Jantine; Kremer, Veerle; Vos, Harmjan R; Huibers, Manon M H; Haigh, Jody J; Huylebroeck, Danny; Boon, Reinier A; Giacca, Mauro; van Rooij, Eva. Cardiomyocytes stimulate angiogenesis after ischemic injury in a ZEB2-dependent manner. Nature Communications. 2021;12(1):84.