Anti ACTN1 pAb (ATL-HPA006035 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA006035-100

Protein Description: actinin, alpha 1
Gene Name: ACTN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015143: 98%, ENSRNOG00000056756: 99%
Entrez Gene ID: 87
Uniprot ID: P12814
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKV
• Gene Sequence: SAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKV
• Gene ID - Mouse: ENSMUSG00000015143
• Gene ID - Rat: ENSRNOG00000056756
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ACTN1 pAb (ATL-HPA006035 w/enhanced validation) – 4 Found

Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. 

Sartaj, R; Zhang, C; Wan, P; Pasha, Z; Guaiquil, V; Liu, A; Liu, J; Luo, Y; Fuchs, E; Rosenblatt, M I. Characterization of slow cycling corneal limbal epithelial cells identifies putative stem cell markers. Scientific Reports. 2017;7(1):3793. 

Jankowska, Katarzyna I; Williamson, Edward K; Roy, Nathan H; Blumenthal, Daniel; Chandra, Vidhi; Baumgart, Tobias; Burkhardt, Janis K. Integrins Modulate T Cell Receptor Signaling by Constraining Actin Flow at the Immunological Synapse. Frontiers In Immunology. 9( 29403502):25. 

Liu, Li; Kryvokhyzha, Dmytro; Rippe, Catarina; Jacob, Aishwarya; Borreguero-Muñoz, Andrea; Stenkula, Karin G; Hansson, Ola; Smith, Christopher W J; Fisher, Steven A; Swärd, Karl. Myocardin regulates exon usage in smooth muscle cells through induction of splicing regulatory factors. Cellular And Molecular Life Sciences : Cmls. 2022;79(8):459.