Anti ACTN1 pAb (ATL-HPA006035 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA006035-100
- Shipping:
- Calculated at Checkout
$593.00
Gene Name: ACTN1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015143: 98%, ENSRNOG00000056756: 99%
Entrez Gene ID: 87
Uniprot ID: P12814
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | SAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKV |
| Gene Sequence | SAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDDPLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKV |
| Gene ID - Mouse | ENSMUSG00000015143 |
| Gene ID - Rat | ENSRNOG00000056756 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACTN1 pAb (ATL-HPA006035 w/enhanced validation) | |
| Datasheet | Anti ACTN1 pAb (ATL-HPA006035 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACTN1 pAb (ATL-HPA006035 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACTN1 pAb (ATL-HPA006035 w/enhanced validation) | |
| Datasheet | Anti ACTN1 pAb (ATL-HPA006035 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACTN1 pAb (ATL-HPA006035 w/enhanced validation) |
| Citations for Anti ACTN1 pAb (ATL-HPA006035 w/enhanced validation) – 4 Found |
| Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23. PubMed |
| Sartaj, R; Zhang, C; Wan, P; Pasha, Z; Guaiquil, V; Liu, A; Liu, J; Luo, Y; Fuchs, E; Rosenblatt, M I. Characterization of slow cycling corneal limbal epithelial cells identifies putative stem cell markers. Scientific Reports. 2017;7(1):3793. PubMed |
| Jankowska, Katarzyna I; Williamson, Edward K; Roy, Nathan H; Blumenthal, Daniel; Chandra, Vidhi; Baumgart, Tobias; Burkhardt, Janis K. Integrins Modulate T Cell Receptor Signaling by Constraining Actin Flow at the Immunological Synapse. Frontiers In Immunology. 9( 29403502):25. PubMed |
| Liu, Li; Kryvokhyzha, Dmytro; Rippe, Catarina; Jacob, Aishwarya; Borreguero-Muñoz, Andrea; Stenkula, Karin G; Hansson, Ola; Smith, Christopher W J; Fisher, Steven A; Swärd, Karl. Myocardin regulates exon usage in smooth muscle cells through induction of splicing regulatory factors. Cellular And Molecular Life Sciences : Cmls. 2022;79(8):459. PubMed |