Anti ACTL9 pAb (ATL-HPA019231)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019231-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ACTL9
Alternative Gene Name: MGC33407
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092519: 62%, ENSRNOG00000049571: 51%
Entrez Gene ID: 284382
Uniprot ID: Q8TC94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MDASRPKSSESQSSLEAPRPGPNPSPNVVNKPLQRDFPGMVADRLPPKTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGL |
Gene Sequence | MDASRPKSSESQSSLEAPRPGPNPSPNVVNKPLQRDFPGMVADRLPPKTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGL |
Gene ID - Mouse | ENSMUSG00000092519 |
Gene ID - Rat | ENSRNOG00000049571 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACTL9 pAb (ATL-HPA019231) | |
Datasheet | Anti ACTL9 pAb (ATL-HPA019231) Datasheet (External Link) |
Vendor Page | Anti ACTL9 pAb (ATL-HPA019231) at Atlas Antibodies |
Documents & Links for Anti ACTL9 pAb (ATL-HPA019231) | |
Datasheet | Anti ACTL9 pAb (ATL-HPA019231) Datasheet (External Link) |
Vendor Page | Anti ACTL9 pAb (ATL-HPA019231) |