Anti ACTL9 pAb (ATL-HPA019231)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019231-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ACTL9
Alternative Gene Name: MGC33407
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092519: 62%, ENSRNOG00000049571: 51%
Entrez Gene ID: 284382
Uniprot ID: Q8TC94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MDASRPKSSESQSSLEAPRPGPNPSPNVVNKPLQRDFPGMVADRLPPKTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGL |
| Gene Sequence | MDASRPKSSESQSSLEAPRPGPNPSPNVVNKPLQRDFPGMVADRLPPKTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGL |
| Gene ID - Mouse | ENSMUSG00000092519 |
| Gene ID - Rat | ENSRNOG00000049571 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACTL9 pAb (ATL-HPA019231) | |
| Datasheet | Anti ACTL9 pAb (ATL-HPA019231) Datasheet (External Link) |
| Vendor Page | Anti ACTL9 pAb (ATL-HPA019231) at Atlas Antibodies |
| Documents & Links for Anti ACTL9 pAb (ATL-HPA019231) | |
| Datasheet | Anti ACTL9 pAb (ATL-HPA019231) Datasheet (External Link) |
| Vendor Page | Anti ACTL9 pAb (ATL-HPA019231) |