Anti ACTL9 pAb (ATL-HPA019231)

Atlas Antibodies

Catalog No.:
ATL-HPA019231-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: actin-like 9
Gene Name: ACTL9
Alternative Gene Name: MGC33407
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000092519: 62%, ENSRNOG00000049571: 51%
Entrez Gene ID: 284382
Uniprot ID: Q8TC94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MDASRPKSSESQSSLEAPRPGPNPSPNVVNKPLQRDFPGMVADRLPPKTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGL
Gene Sequence MDASRPKSSESQSSLEAPRPGPNPSPNVVNKPLQRDFPGMVADRLPPKTGAVVIDMGTGTCKVGFAGQASPTYTVATILGCQPKKPATSGQSGL
Gene ID - Mouse ENSMUSG00000092519
Gene ID - Rat ENSRNOG00000049571
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACTL9 pAb (ATL-HPA019231)
Datasheet Anti ACTL9 pAb (ATL-HPA019231) Datasheet (External Link)
Vendor Page Anti ACTL9 pAb (ATL-HPA019231) at Atlas Antibodies

Documents & Links for Anti ACTL9 pAb (ATL-HPA019231)
Datasheet Anti ACTL9 pAb (ATL-HPA019231) Datasheet (External Link)
Vendor Page Anti ACTL9 pAb (ATL-HPA019231)