Anti ACTL7B pAb (ATL-HPA021803 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA021803-25

• 
• 

Protein Description: actin-like 7B
Gene Name: ACTL7B
Alternative Gene Name: Tact1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070980: 74%, ENSRNOG00000016621: 76%
Entrez Gene ID: 10880
Uniprot ID: Q9Y614
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MATRNSPMPLGTAQGDPGEAGTRPGPDASLRDTGAATQLKMKPRKVHKIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTL
• Gene Sequence: MATRNSPMPLGTAQGDPGEAGTRPGPDASLRDTGAATQLKMKPRKVHKIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTL
• Gene ID - Mouse: ENSMUSG00000070980
• Gene ID - Rat: ENSRNOG00000016621
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ACTL7B pAb (ATL-HPA021803 w/enhanced validation) – 3 Found

Andersson, Sandra; Konrad, Anna; Ashok, Nikhil; Pontén, Fredrik; Hober, Sophia; Asplund, Anna. Antibodies biotinylated using a synthetic Z-domain from protein A provide stringent in situ protein detection. The Journal Of Histochemistry And Cytochemistry : Official Journal Of The Histochemistry Society. 2013;61(11):773-84. 

Djureinovic, D; Fagerberg, L; Hallström, B; Danielsson, A; Lindskog, C; Uhlén, M; Pontén, F. The human testis-specific proteome defined by transcriptomics and antibody-based profiling. Molecular Human Reproduction. 2014;20(6):476-88. 

Cadalbert, Laurence C; Ghaffar, Farah Naz; Stevenson, David; Bryson, Sheila; Vaz, Frédéric M; Gottlieb, Eyal; Strathdee, Douglas. Mouse Tafazzin Is Required for Male Germ Cell Meiosis and Spermatogenesis. Plos One. 10(6):e0131066.