Anti ACTL7A pAb (ATL-HPA021624 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA021624-25

• 

Protein Description: actin-like 7A
Gene Name: ACTL7A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070979: 70%, ENSRNOG00000016641: 71%
Entrez Gene ID: 10881
Uniprot ID: Q9Y615
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSEPQEPTESKAAKERPKQEVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGK
• Gene Sequence: MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSEPQEPTESKAAKERPKQEVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGK
• Gene ID - Mouse: ENSMUSG00000070979
• Gene ID - Rat: ENSRNOG00000016641
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ACTL7A pAb (ATL-HPA021624 w/enhanced validation) – 2 Found

Xin, Aijie; Qu, Ronggui; Chen, Guowu; Zhang, Ling; Chen, Junling; Tao, Chengqiu; Fu, Jing; Tang, Jianan; Ru, Yanfei; Chen, Ying; Peng, Xiandong; Shi, Huijuan; Zhang, Feng; Sun, Xiaoxi. Disruption in ACTL7A causes acrosomal ultrastructural defects in human and mouse sperm as a novel male factor inducing early embryonic arrest. Science Advances. 2020;6(35):eaaz4796. 

Yu, Hui; Shi, Xiao; Shao, Zhongmei; Geng, Hao; Guo, Senzhao; Li, Kuokuo; Gu, Meng; Xu, Chuan; Gao, Yang; Tan, Qing; Duan, Zongliu; Wu, Huan; Hua, Rong; Guo, Rui; Wei, Zhaolian; Zhou, Ping; Cao, Yunxia; He, Xiaojin; Li, Liang; Zhang, Xiaoping; Lv, Mingrong. Novel HYDIN variants associated with male infertility in two Chinese families. Frontiers In Endocrinology. 14( 36742411):1118841.