Anti ACTB pAb (ATL-HPA041271)

Atlas Antibodies

Catalog No.:
ATL-HPA041271-25
Shipping:
Calculated at Checkout
$328.00
Adding to cart… The item has been added
Protein Description: actin, beta
Gene Name: ACTB
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000062825: 100%, ENSRNOG00000034254: 100%
Entrez Gene ID: 60
Uniprot ID: P60709
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD
Gene Sequence MVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWD
Gene ID - Mouse ENSMUSG00000062825
Gene ID - Rat ENSRNOG00000034254
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACTB pAb (ATL-HPA041271)
Datasheet Anti ACTB pAb (ATL-HPA041271) Datasheet (External Link)
Vendor Page Anti ACTB pAb (ATL-HPA041271) at Atlas Antibodies

Documents & Links for Anti ACTB pAb (ATL-HPA041271)
Datasheet Anti ACTB pAb (ATL-HPA041271) Datasheet (External Link)
Vendor Page Anti ACTB pAb (ATL-HPA041271)