Anti ACSS2 pAb (ATL-HPA004141)

Atlas Antibodies

SKU:
ATL-HPA004141-100
  • Immunohistochemical staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, cytosol & vesicles.
  • Western blot analysis in human cell line RPMI-8226.
Shipping:
Calculated at Checkout
$596.00
Adding to cart… The item has been added
Protein Description: acyl-CoA synthetase short-chain family member 2
Gene Name: ACSS2
Alternative Gene Name: ACAS2, AceCS, ACS, ACSA, dJ1161H23.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027605: 91%, ENSRNOG00000018755: 90%
Entrez Gene ID: 55902
Uniprot ID: Q9NR19
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQ
Gene Sequence PGETTQITYHQLLVQVCQFSNVLRKQGIQKGDRVAIYMPMIPELVVAMLACARIGALHSIVFAGFSSESLCERILDSSCSLLITTDAFYRGEKLVNLKELADEALQKCQEKGFPVRCCIVVKHLGRAELGMGDSTSQSPPIKRSCPDVQ
Gene ID - Mouse ENSMUSG00000027605
Gene ID - Rat ENSRNOG00000018755
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACSS2 pAb (ATL-HPA004141)
Datasheet Anti ACSS2 pAb (ATL-HPA004141) Datasheet (External Link)
Vendor Page Anti ACSS2 pAb (ATL-HPA004141) at Atlas Antibodies

Documents & Links for Anti ACSS2 pAb (ATL-HPA004141)
Datasheet Anti ACSS2 pAb (ATL-HPA004141) Datasheet (External Link)
Vendor Page Anti ACSS2 pAb (ATL-HPA004141)



Citations for Anti ACSS2 pAb (ATL-HPA004141) – 3 Found
Kendrick, Stuart F W; O'Boyle, Graeme; Mann, Jelena; Zeybel, Mujdat; Palmer, Jeremy; Jones, David E J; Day, Chris P. Acetate, the key modulator of inflammatory responses in acute alcoholic hepatitis. Hepatology (Baltimore, Md.). 2010;51(6):1988-97.  PubMed
Schug, Zachary T; Peck, Barrie; Jones, Dylan T; Zhang, Qifeng; Grosskurth, Shaun; Alam, Israt S; Goodwin, Louise M; Smethurst, Elizabeth; Mason, Susan; Blyth, Karen; McGarry, Lynn; James, Daniel; Shanks, Emma; Kalna, Gabriela; Saunders, Rebecca E; Jiang, Ming; Howell, Michael; Lassailly, Francois; Thin, May Zaw; Spencer-Dene, Bradley; Stamp, Gordon; van den Broek, Niels J F; Mackay, Gillian; Bulusu, Vinay; Kamphorst, Jurre J; Tardito, Saverio; Strachan, David; Harris, Adrian L; Aboagye, Eric O; Critchlow, Susan E; Wakelam, Michael J O; Schulze, Almut; Gottlieb, Eyal. Acetyl-CoA synthetase 2 promotes acetate utilization and maintains cancer cell growth under metabolic stress. Cancer Cell. 2015;27(1):57-71.  PubMed
Andrades, Evelyn; Toll, Agustí; Deza, Gustavo; Segura, Sonia; Gimeno, Ramón; Espadas, Guadalupe; Sabidó, Eduard; Haro, Noemí; Pozo, Óscar J; Bódalo, Marta; Torres, Paloma; Pujol, Ramon M; Hernández-Muñoz, Inmaculada. Loss of dyskerin facilitates the acquisition of metastatic traits by altering the mevalonate pathway. Life Science Alliance. 2023;6(4)  PubMed