Anti ACSM5 pAb (ATL-HPA041435)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041435-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ACSM5
Alternative Gene Name: FLJ20581
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030972: 64%, ENSRNOG00000031211: 58%
Entrez Gene ID: 54988
Uniprot ID: Q6NUN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYF |
| Gene Sequence | MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYF |
| Gene ID - Mouse | ENSMUSG00000030972 |
| Gene ID - Rat | ENSRNOG00000031211 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACSM5 pAb (ATL-HPA041435) | |
| Datasheet | Anti ACSM5 pAb (ATL-HPA041435) Datasheet (External Link) |
| Vendor Page | Anti ACSM5 pAb (ATL-HPA041435) at Atlas Antibodies |
| Documents & Links for Anti ACSM5 pAb (ATL-HPA041435) | |
| Datasheet | Anti ACSM5 pAb (ATL-HPA041435) Datasheet (External Link) |
| Vendor Page | Anti ACSM5 pAb (ATL-HPA041435) |