Anti ACSM5 pAb (ATL-HPA041435)

Atlas Antibodies

Catalog No.:
ATL-HPA041435-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: acyl-CoA synthetase medium-chain family member 5
Gene Name: ACSM5
Alternative Gene Name: FLJ20581
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030972: 64%, ENSRNOG00000031211: 58%
Entrez Gene ID: 54988
Uniprot ID: Q6NUN0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYF
Gene Sequence MRPWLRHLVLQALRNSRAFCGSHGKPAPLPVPQKIVATWEAISLGRQLVPEYF
Gene ID - Mouse ENSMUSG00000030972
Gene ID - Rat ENSRNOG00000031211
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACSM5 pAb (ATL-HPA041435)
Datasheet Anti ACSM5 pAb (ATL-HPA041435) Datasheet (External Link)
Vendor Page Anti ACSM5 pAb (ATL-HPA041435) at Atlas Antibodies

Documents & Links for Anti ACSM5 pAb (ATL-HPA041435)
Datasheet Anti ACSM5 pAb (ATL-HPA041435) Datasheet (External Link)
Vendor Page Anti ACSM5 pAb (ATL-HPA041435)