Anti ACSM4 pAb (ATL-HPA049895)
Atlas Antibodies
- Catalog No.:
- ATL-HPA049895-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ACSM4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047026: 72%, ENSRNOG00000014726: 74%
Entrez Gene ID: 341392
Uniprot ID: P0C7M7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FRYQTFRFIWLTKPPGRRLHKDHQLWTPLTLADFEAINRCNRPLPKNFNFAADV |
Gene Sequence | FRYQTFRFIWLTKPPGRRLHKDHQLWTPLTLADFEAINRCNRPLPKNFNFAADV |
Gene ID - Mouse | ENSMUSG00000047026 |
Gene ID - Rat | ENSRNOG00000014726 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACSM4 pAb (ATL-HPA049895) | |
Datasheet | Anti ACSM4 pAb (ATL-HPA049895) Datasheet (External Link) |
Vendor Page | Anti ACSM4 pAb (ATL-HPA049895) at Atlas Antibodies |
Documents & Links for Anti ACSM4 pAb (ATL-HPA049895) | |
Datasheet | Anti ACSM4 pAb (ATL-HPA049895) Datasheet (External Link) |
Vendor Page | Anti ACSM4 pAb (ATL-HPA049895) |
Citations for Anti ACSM4 pAb (ATL-HPA049895) – 1 Found |
Kurihara, Sho; Tei, Masayoshi; Hata, Junichi; Mori, Eri; Fujioka, Masato; Matsuwaki, Yoshinori; Otori, Nobuyoshi; Kojima, Hiromi; Okano, Hirotaka James. MRI tractography reveals the human olfactory nerve map connecting the olfactory epithelium and olfactory bulb. Communications Biology. 2022;5(1):843. PubMed |