Anti ACSM4 pAb (ATL-HPA049895)

Atlas Antibodies

Catalog No.: ATL-HPA049895-25

Protein Description: acyl-CoA synthetase medium-chain family member 4
Gene Name: ACSM4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047026: 72%, ENSRNOG00000014726: 74%
Entrez Gene ID: 341392
Uniprot ID: P0C7M7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: FRYQTFRFIWLTKPPGRRLHKDHQLWTPLTLADFEAINRCNRPLPKNFNFAADV
• Gene Sequence: FRYQTFRFIWLTKPPGRRLHKDHQLWTPLTLADFEAINRCNRPLPKNFNFAADV
• Gene ID - Mouse: ENSMUSG00000047026
• Gene ID - Rat: ENSRNOG00000014726
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ACSM4 pAb (ATL-HPA049895) – 1 Found

Kurihara, Sho; Tei, Masayoshi; Hata, Junichi; Mori, Eri; Fujioka, Masato; Matsuwaki, Yoshinori; Otori, Nobuyoshi; Kojima, Hiromi; Okano, Hirotaka James. MRI tractography reveals the human olfactory nerve map connecting the olfactory epithelium and olfactory bulb. Communications Biology. 2022;5(1):843.