Anti ACSM4 pAb (ATL-HPA049895)

Atlas Antibodies

Catalog No.:
ATL-HPA049895-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: acyl-CoA synthetase medium-chain family member 4
Gene Name: ACSM4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047026: 72%, ENSRNOG00000014726: 74%
Entrez Gene ID: 341392
Uniprot ID: P0C7M7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FRYQTFRFIWLTKPPGRRLHKDHQLWTPLTLADFEAINRCNRPLPKNFNFAADV
Gene Sequence FRYQTFRFIWLTKPPGRRLHKDHQLWTPLTLADFEAINRCNRPLPKNFNFAADV
Gene ID - Mouse ENSMUSG00000047026
Gene ID - Rat ENSRNOG00000014726
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACSM4 pAb (ATL-HPA049895)
Datasheet Anti ACSM4 pAb (ATL-HPA049895) Datasheet (External Link)
Vendor Page Anti ACSM4 pAb (ATL-HPA049895) at Atlas Antibodies

Documents & Links for Anti ACSM4 pAb (ATL-HPA049895)
Datasheet Anti ACSM4 pAb (ATL-HPA049895) Datasheet (External Link)
Vendor Page Anti ACSM4 pAb (ATL-HPA049895)
Citations for Anti ACSM4 pAb (ATL-HPA049895) – 1 Found
Kurihara, Sho; Tei, Masayoshi; Hata, Junichi; Mori, Eri; Fujioka, Masato; Matsuwaki, Yoshinori; Otori, Nobuyoshi; Kojima, Hiromi; Okano, Hirotaka James. MRI tractography reveals the human olfactory nerve map connecting the olfactory epithelium and olfactory bulb. Communications Biology. 2022;5(1):843.  PubMed