Anti ACSM3 pAb (ATL-HPA041013)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041013-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ACSM3
Alternative Gene Name: SA, SAH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030935: 82%, ENSRNOG00000032246: 81%
Entrez Gene ID: 6296
Uniprot ID: Q53FZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | KANCIITNDVLAPAVDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFF |
| Gene Sequence | KANCIITNDVLAPAVDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFF |
| Gene ID - Mouse | ENSMUSG00000030935 |
| Gene ID - Rat | ENSRNOG00000032246 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACSM3 pAb (ATL-HPA041013) | |
| Datasheet | Anti ACSM3 pAb (ATL-HPA041013) Datasheet (External Link) |
| Vendor Page | Anti ACSM3 pAb (ATL-HPA041013) at Atlas Antibodies |
| Documents & Links for Anti ACSM3 pAb (ATL-HPA041013) | |
| Datasheet | Anti ACSM3 pAb (ATL-HPA041013) Datasheet (External Link) |
| Vendor Page | Anti ACSM3 pAb (ATL-HPA041013) |