Anti ACSM3 pAb (ATL-HPA041013)

Atlas Antibodies

Catalog No.:
ATL-HPA041013-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: acyl-CoA synthetase medium-chain family member 3
Gene Name: ACSM3
Alternative Gene Name: SA, SAH
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030935: 82%, ENSRNOG00000032246: 81%
Entrez Gene ID: 6296
Uniprot ID: Q53FZ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KANCIITNDVLAPAVDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFF
Gene Sequence KANCIITNDVLAPAVDAVASKCENLHSKLIVSENSREGWGNLKELMKHASDSHTCVKTKHNEIMAIFF
Gene ID - Mouse ENSMUSG00000030935
Gene ID - Rat ENSRNOG00000032246
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACSM3 pAb (ATL-HPA041013)
Datasheet Anti ACSM3 pAb (ATL-HPA041013) Datasheet (External Link)
Vendor Page Anti ACSM3 pAb (ATL-HPA041013) at Atlas Antibodies

Documents & Links for Anti ACSM3 pAb (ATL-HPA041013)
Datasheet Anti ACSM3 pAb (ATL-HPA041013) Datasheet (External Link)
Vendor Page Anti ACSM3 pAb (ATL-HPA041013)