Anti ACSM2A pAb (ATL-HPA057699)

Atlas Antibodies

Catalog No.:
ATL-HPA057699-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: acyl-CoA synthetase medium-chain family member 2A
Gene Name: ACSM2A
Alternative Gene Name: A-923A4.1, ACSM2, MGC150530
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030945: 60%, ENSRNOG00000042084: 64%
Entrez Gene ID: 123876
Uniprot ID: Q08AH3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LRKVQGLCTLWGTQMSSRTLYINSRQLVSLQWGHQEVPAKFNFASDVLDHWAD
Gene Sequence LRKVQGLCTLWGTQMSSRTLYINSRQLVSLQWGHQEVPAKFNFASDVLDHWAD
Gene ID - Mouse ENSMUSG00000030945
Gene ID - Rat ENSRNOG00000042084
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACSM2A pAb (ATL-HPA057699)
Datasheet Anti ACSM2A pAb (ATL-HPA057699) Datasheet (External Link)
Vendor Page Anti ACSM2A pAb (ATL-HPA057699) at Atlas Antibodies

Documents & Links for Anti ACSM2A pAb (ATL-HPA057699)
Datasheet Anti ACSM2A pAb (ATL-HPA057699) Datasheet (External Link)
Vendor Page Anti ACSM2A pAb (ATL-HPA057699)