Anti ACSM1 pAb (ATL-HPA046291)

Atlas Antibodies

Catalog No.:
ATL-HPA046291-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: acyl-CoA synthetase medium-chain family member 1
Gene Name: ACSM1
Alternative Gene Name: BUCS1, MACS1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033533: 58%, ENSRNOG00000042084: 57%
Entrez Gene ID: 116285
Uniprot ID: Q08AH1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen HHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG
Gene Sequence HHLPQFDTKVIIQTLLKYPINHFWGVSSIYRMILQQDFTSIRFPALEHCYTGGEVVLPKDQEEWKRRTG
Gene ID - Mouse ENSMUSG00000033533
Gene ID - Rat ENSRNOG00000042084
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACSM1 pAb (ATL-HPA046291)
Datasheet Anti ACSM1 pAb (ATL-HPA046291) Datasheet (External Link)
Vendor Page Anti ACSM1 pAb (ATL-HPA046291) at Atlas Antibodies

Documents & Links for Anti ACSM1 pAb (ATL-HPA046291)
Datasheet Anti ACSM1 pAb (ATL-HPA046291) Datasheet (External Link)
Vendor Page Anti ACSM1 pAb (ATL-HPA046291)