Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA007162-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ACSL5
Alternative Gene Name: ACS2, ACS5, FACL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024981: 76%, ENSRNOG00000016265: 77%
Entrez Gene ID: 51703
Uniprot ID: Q9ULC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK |
| Gene Sequence | VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK |
| Gene ID - Mouse | ENSMUSG00000024981 |
| Gene ID - Rat | ENSRNOG00000016265 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) | |
| Datasheet | Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) | |
| Datasheet | Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) |
| Citations for Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) – 1 Found |
| Menon, Deepak; Salloum, Darin; Bernfeld, Elyssa; Gorodetsky, Elizabeth; Akselrod, Alla; Frias, Maria A; Sudderth, Jessica; Chen, Pei-Hsuan; DeBerardinis, Ralph; Foster, David A. Lipid sensing by mTOR complexes via de novo synthesis of phosphatidic acid. The Journal Of Biological Chemistry. 2017;292(15):6303-6311. PubMed |