Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA007162-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ACSL5
Alternative Gene Name: ACS2, ACS5, FACL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024981: 76%, ENSRNOG00000016265: 77%
Entrez Gene ID: 51703
Uniprot ID: Q9ULC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK |
Gene Sequence | VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK |
Gene ID - Mouse | ENSMUSG00000024981 |
Gene ID - Rat | ENSRNOG00000016265 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) | |
Datasheet | Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) | |
Datasheet | Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) |
Citations for Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) – 1 Found |
Menon, Deepak; Salloum, Darin; Bernfeld, Elyssa; Gorodetsky, Elizabeth; Akselrod, Alla; Frias, Maria A; Sudderth, Jessica; Chen, Pei-Hsuan; DeBerardinis, Ralph; Foster, David A. Lipid sensing by mTOR complexes via de novo synthesis of phosphatidic acid. The Journal Of Biological Chemistry. 2017;292(15):6303-6311. PubMed |