Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA007162-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: acyl-CoA synthetase long-chain family member 5
Gene Name: ACSL5
Alternative Gene Name: ACS2, ACS5, FACL5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024981: 76%, ENSRNOG00000016265: 77%
Entrez Gene ID: 51703
Uniprot ID: Q9ULC5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK
Gene Sequence VHIVNKADIAMVICDTPQKALVLIGNVEKGFTPSLKVIILMDPFDDDLKQRGEKSGIEILSLYDAENLGKEHFRKPVPPSPEDLSVICFTSGTTGDPK
Gene ID - Mouse ENSMUSG00000024981
Gene ID - Rat ENSRNOG00000016265
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation)
Datasheet Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation)
Datasheet Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation)
Citations for Anti ACSL5 pAb (ATL-HPA007162 w/enhanced validation) – 1 Found
Menon, Deepak; Salloum, Darin; Bernfeld, Elyssa; Gorodetsky, Elizabeth; Akselrod, Alla; Frias, Maria A; Sudderth, Jessica; Chen, Pei-Hsuan; DeBerardinis, Ralph; Foster, David A. Lipid sensing by mTOR complexes via de novo synthesis of phosphatidic acid. The Journal Of Biological Chemistry. 2017;292(15):6303-6311.  PubMed