Anti ACSL3 pAb (ATL-HPA071021)
Atlas Antibodies
- Catalog No.:
- ATL-HPA071021-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ACSL3
Alternative Gene Name: ACS3, FACL3, PRO2194
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032883: 89%, ENSRNOG00000014718: 89%
Entrez Gene ID: 2181
Uniprot ID: O95573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGT |
Gene Sequence | KSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGT |
Gene ID - Mouse | ENSMUSG00000032883 |
Gene ID - Rat | ENSRNOG00000014718 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACSL3 pAb (ATL-HPA071021) | |
Datasheet | Anti ACSL3 pAb (ATL-HPA071021) Datasheet (External Link) |
Vendor Page | Anti ACSL3 pAb (ATL-HPA071021) at Atlas Antibodies |
Documents & Links for Anti ACSL3 pAb (ATL-HPA071021) | |
Datasheet | Anti ACSL3 pAb (ATL-HPA071021) Datasheet (External Link) |
Vendor Page | Anti ACSL3 pAb (ATL-HPA071021) |