Anti ACSL3 pAb (ATL-HPA071021)

Atlas Antibodies

SKU: ATL-HPA071021-25

• 

Protein Description: acyl-CoA synthetase long-chain family member 3
Gene Name: ACSL3
Alternative Gene Name: ACS3, FACL3, PRO2194
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032883: 89%, ENSRNOG00000014718: 89%
Entrez Gene ID: 2181
Uniprot ID: O95573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGT
• Gene Sequence: KSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGT
• Gene ID - Mouse: ENSMUSG00000032883
• Gene ID - Rat: ENSRNOG00000014718
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.