Anti ACSL3 pAb (ATL-HPA071021)

Atlas Antibodies

Catalog No.:
ATL-HPA071021-25
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: acyl-CoA synthetase long-chain family member 3
Gene Name: ACSL3
Alternative Gene Name: ACS3, FACL3, PRO2194
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032883: 89%, ENSRNOG00000014718: 89%
Entrez Gene ID: 2181
Uniprot ID: O95573
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen KSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGT
Gene Sequence KSNRIKAKPVNSKPDSAYRSVNSLDGLASVLYPGCDTLDKVFTYAKNKFKNKRLLGT
Gene ID - Mouse ENSMUSG00000032883
Gene ID - Rat ENSRNOG00000014718
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACSL3 pAb (ATL-HPA071021)
Datasheet Anti ACSL3 pAb (ATL-HPA071021) Datasheet (External Link)
Vendor Page Anti ACSL3 pAb (ATL-HPA071021) at Atlas Antibodies

Documents & Links for Anti ACSL3 pAb (ATL-HPA071021)
Datasheet Anti ACSL3 pAb (ATL-HPA071021) Datasheet (External Link)
Vendor Page Anti ACSL3 pAb (ATL-HPA071021)