Anti ACSL1 pAb (ATL-HPA011964 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA011964-25

• 
• 
• 

Protein Description: acyl-CoA synthetase long-chain family member 1
Gene Name: ACSL1
Alternative Gene Name: ACS1, FACL1, FACL2, LACS, LACS1, LACS2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018796: 81%, ENSRNOG00000010633: 80%
Entrez Gene ID: 2180
Uniprot ID: P33121
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQRCGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICFTSGTTGNPKGAMVTHRN
• Gene Sequence: IIEQGCFAYSMVIVPLYDTLGNEAITYIVNKAELSLVFVDKPEKAKLLLEGVENKLIPGLKIIVVMDAYGSELVERGQRCGVEVTSMKAMEDLGRANRRKPKPPAPEDLAVICFTSGTTGNPKGAMVTHRN
• Gene ID - Mouse: ENSMUSG00000018796
• Gene ID - Rat: ENSRNOG00000010633
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.