Anti ACSF2 pAb (ATL-HPA024693 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA024693-25

• 
• 
• 

Protein Description: acyl-CoA synthetase family member 2
Gene Name: ACSF2
Alternative Gene Name: ACSMW, FLJ20920
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000076435: 81%, ENSRNOG00000003330: 81%
Entrez Gene ID: 80221
Uniprot ID: Q96CM8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GTLAKLNTPGELCIRGYCVMLGYWGEPQKTEEAVDQDKWYWTGDVATMNEQGFCKIVGRSKDMIIRGGEN
• Gene Sequence: GTLAKLNTPGELCIRGYCVMLGYWGEPQKTEEAVDQDKWYWTGDVATMNEQGFCKIVGRSKDMIIRGGEN
• Gene ID - Mouse: ENSMUSG00000076435
• Gene ID - Rat: ENSRNOG00000003330
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.