Anti ACSBG2 pAb (ATL-HPA043421 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA043421-25
  • Immunohistochemistry analysis in human testis and endometrium tissues using Anti-ACSBG2 antibody. Corresponding ACSBG2 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to cytosol.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: acyl-CoA synthetase bubblegum family member 2
Gene Name: ACSBG2
Alternative Gene Name: BGR, DKFZp434K1635, PRTD-NY3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024207: 61%, ENSRNOG00000045947: 68%
Entrez Gene ID: 81616
Uniprot ID: Q5FVE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDF
Gene Sequence LKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQDPLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDF
Gene ID - Mouse ENSMUSG00000024207
Gene ID - Rat ENSRNOG00000045947
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ACSBG2 pAb (ATL-HPA043421 w/enhanced validation)
Datasheet Anti ACSBG2 pAb (ATL-HPA043421 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACSBG2 pAb (ATL-HPA043421 w/enhanced validation)