Anti ACSBG1 pAb (ATL-HPA041642 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA041642-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ACSBG1
Alternative Gene Name: BG1, BGM, FLJ30320, hBG1, hsBG, KIAA0631, MGC14352
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032281: 91%, ENSRNOG00000011381: 91%
Entrez Gene ID: 23205
Uniprot ID: Q96GR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLV |
| Gene Sequence | ANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLV |
| Gene ID - Mouse | ENSMUSG00000032281 |
| Gene ID - Rat | ENSRNOG00000011381 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACSBG1 pAb (ATL-HPA041642 w/enhanced validation) | |
| Datasheet | Anti ACSBG1 pAb (ATL-HPA041642 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACSBG1 pAb (ATL-HPA041642 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACSBG1 pAb (ATL-HPA041642 w/enhanced validation) | |
| Datasheet | Anti ACSBG1 pAb (ATL-HPA041642 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACSBG1 pAb (ATL-HPA041642 w/enhanced validation) |