Anti ACSBG1 pAb (ATL-HPA041642 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA041642-25

• 
• 

Protein Description: acyl-CoA synthetase bubblegum family member 1
Gene Name: ACSBG1
Alternative Gene Name: BG1, BGM, FLJ30320, hBG1, hsBG, KIAA0631, MGC14352
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032281: 91%, ENSRNOG00000011381: 91%
Entrez Gene ID: 23205
Uniprot ID: Q96GR2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLV
• Gene Sequence: ANVIMVDTQKQLEKILKIWKQLPHLKAVVIYKEPPPNKMANVYTMEEFMELGNEVPEEALDAIIDTQQPNQCCVLV
• Gene ID - Mouse: ENSMUSG00000032281
• Gene ID - Rat: ENSRNOG00000011381
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.