Anti ACRBP pAb (ATL-HPA039082 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA039082-25
  • Immunohistochemistry analysis in human testis and endometrium tissues using Anti-ACRBP antibody. Corresponding ACRBP RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: acrosin binding protein
Gene Name: ACRBP
Alternative Gene Name: CT23, OY-TES-1, SP32
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072770: 65%, ENSRNOG00000017399: 68%
Entrez Gene ID: 84519
Uniprot ID: Q8NEB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AKRVLCSQPVSILSPNTLKEIEASAEVSPTTMTSPISPHFTVTERQTFQPWPERLSNNVEELLQSSLSLGGQEQAPEHKQEQGVEHRQEPTQEHKQE
Gene Sequence AKRVLCSQPVSILSPNTLKEIEASAEVSPTTMTSPISPHFTVTERQTFQPWPERLSNNVEELLQSSLSLGGQEQAPEHKQEQGVEHRQEPTQEHKQE
Gene ID - Mouse ENSMUSG00000072770
Gene ID - Rat ENSRNOG00000017399
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACRBP pAb (ATL-HPA039082 w/enhanced validation)
Datasheet Anti ACRBP pAb (ATL-HPA039082 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACRBP pAb (ATL-HPA039082 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACRBP pAb (ATL-HPA039082 w/enhanced validation)
Datasheet Anti ACRBP pAb (ATL-HPA039082 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACRBP pAb (ATL-HPA039082 w/enhanced validation)



Citations for Anti ACRBP pAb (ATL-HPA039082 w/enhanced validation) – 1 Found
Djureinovic, Dijana; Hallström, Björn M; Horie, Masafumi; Mattsson, Johanna Sofia Margareta; La Fleur, Linnea; Fagerberg, Linn; Brunnström, Hans; Lindskog, Cecilia; Madjar, Katrin; Rahnenführer, Jörg; Ekman, Simon; Ståhle, Elisabeth; Koyi, Hirsh; Brandén, Eva; Edlund, Karolina; Hengstler, Jan G; Lambe, Mats; Saito, Akira; Botling, Johan; Pontén, Fredrik; Uhlén, Mathias; Micke, Patrick. Profiling cancer testis antigens in non-small-cell lung cancer. Jci Insight. 2016;1(10):e86837.  PubMed