Anti ACPP pAb (ATL-HPA063916 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA063916-100

Protein Description: acid phosphatase, prostate
Gene Name: ACPP
Alternative Gene Name: ACP-3, ACP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032561: 73%, ENSRNOG00000011820: 70%
Entrez Gene ID: 55
Uniprot ID: P15309
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELVGPVIPQDWSTECMTTNSHQGT
• Gene Sequence: LTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELVGPVIPQDWSTECMTTNSHQGT
• Gene ID - Mouse: ENSMUSG00000032561
• Gene ID - Rat: ENSRNOG00000011820
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.