Anti ACPP pAb (ATL-HPA063916 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA063916-100
  • Immunohistochemistry analysis in human prostate and endometrium tissues using Anti-ACPP antibody. Corresponding ACPP RNA-seq data are presented for the same tissues.
  • Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251 MG
Shipping:
Calculated at Checkout
$554.00
Adding to cart… The item has been added
Protein Description: acid phosphatase, prostate
Gene Name: ACPP
Alternative Gene Name: ACP-3, ACP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032561: 73%, ENSRNOG00000011820: 70%
Entrez Gene ID: 55
Uniprot ID: P15309
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELVGPVIPQDWSTECMTTNSHQGT
Gene Sequence LTELYFEKGEYFVEMYYRNETQHEPYPLMLPGCSPSCPLERFAELVGPVIPQDWSTECMTTNSHQGT
Gene ID - Mouse ENSMUSG00000032561
Gene ID - Rat ENSRNOG00000011820
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACPP pAb (ATL-HPA063916 w/enhanced validation)
Datasheet Anti ACPP pAb (ATL-HPA063916 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACPP pAb (ATL-HPA063916 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACPP pAb (ATL-HPA063916 w/enhanced validation)
Datasheet Anti ACPP pAb (ATL-HPA063916 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACPP pAb (ATL-HPA063916 w/enhanced validation)