Anti ACP7 pAb (ATL-HPA042005)

Atlas Antibodies

Catalog No.:
ATL-HPA042005-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: acid phosphatase 7, tartrate resistant (putative)
Gene Name: ACP7
Alternative Gene Name: FLJ16165, PAPL, PAPL1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037469: 94%, ENSRNOG00000047901: 94%
Entrez Gene ID: 390928
Uniprot ID: Q6ZNF0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PRLAVFGDLGADNPKAVPRLRRDTQQGMYDAVLHVGDFAYNLDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEERYN
Gene Sequence PRLAVFGDLGADNPKAVPRLRRDTQQGMYDAVLHVGDFAYNLDQDNARVGDRFMRLIEPVAASLPYMTCPGNHEERYN
Gene ID - Mouse ENSMUSG00000037469
Gene ID - Rat ENSRNOG00000047901
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACP7 pAb (ATL-HPA042005)
Datasheet Anti ACP7 pAb (ATL-HPA042005) Datasheet (External Link)
Vendor Page Anti ACP7 pAb (ATL-HPA042005) at Atlas Antibodies

Documents & Links for Anti ACP7 pAb (ATL-HPA042005)
Datasheet Anti ACP7 pAb (ATL-HPA042005) Datasheet (External Link)
Vendor Page Anti ACP7 pAb (ATL-HPA042005)