Anti ACP6 pAb (ATL-HPA028560)

Atlas Antibodies

Catalog No.:
ATL-HPA028560-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: acid phosphatase 6, lysophosphatidic
Gene Name: ACP6
Alternative Gene Name: ACPL1, LPAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028093: 67%, ENSRNOG00000017494: 68%
Entrez Gene ID: 51205
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLQPGISEDLKKVKDRMGIDSSDKVDFFILLDNVAAEQAHNLPSCPMLKRFARMIEQRAVDTSLYILPKEDRESLQMAV
Gene Sequence SLQPGISEDLKKVKDRMGIDSSDKVDFFILLDNVAAEQAHNLPSCPMLKRFARMIEQRAVDTSLYILPKEDRESLQMAV
Gene ID - Mouse ENSMUSG00000028093
Gene ID - Rat ENSRNOG00000017494
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACP6 pAb (ATL-HPA028560)
Datasheet Anti ACP6 pAb (ATL-HPA028560) Datasheet (External Link)
Vendor Page Anti ACP6 pAb (ATL-HPA028560) at Atlas Antibodies

Documents & Links for Anti ACP6 pAb (ATL-HPA028560)
Datasheet Anti ACP6 pAb (ATL-HPA028560) Datasheet (External Link)
Vendor Page Anti ACP6 pAb (ATL-HPA028560)