Anti ACP6 pAb (ATL-HPA028560)

Atlas Antibodies

Catalog No.: ATL-HPA028560-25

Protein Description: acid phosphatase 6, lysophosphatidic
Gene Name: ACP6
Alternative Gene Name: ACPL1, LPAP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028093: 67%, ENSRNOG00000017494: 68%
Entrez Gene ID: 51205
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SLQPGISEDLKKVKDRMGIDSSDKVDFFILLDNVAAEQAHNLPSCPMLKRFARMIEQRAVDTSLYILPKEDRESLQMAV
• Gene Sequence: SLQPGISEDLKKVKDRMGIDSSDKVDFFILLDNVAAEQAHNLPSCPMLKRFARMIEQRAVDTSLYILPKEDRESLQMAV
• Gene ID - Mouse: ENSMUSG00000028093
• Gene ID - Rat: ENSRNOG00000017494
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.