Anti ACP1 pAb (ATL-HPA016754)

Atlas Antibodies

SKU:
ATL-HPA016754-25
  • Immunohistochemical staining of human testis shows cytoplasmic positivity of cells in seminiferus ducts.
  • Western blot analysis in human cell line HepG2.
Shipping:
Calculated at Checkout
$395.00
Adding to cart… The item has been added
Protein Description: acid phosphatase 1, soluble
Gene Name: ACP1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044573: 89%, ENSRNOG00000005260: 89%
Entrez Gene ID: 52
Uniprot ID: P24666
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen ENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQ
Gene Sequence ENWRVDSAATSGYEIGNPPDYRGQSCMKRHGIPMSHVARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQ
Gene ID - Mouse ENSMUSG00000044573
Gene ID - Rat ENSRNOG00000005260
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACP1 pAb (ATL-HPA016754)
Datasheet Anti ACP1 pAb (ATL-HPA016754) Datasheet (External Link)
Vendor Page Anti ACP1 pAb (ATL-HPA016754) at Atlas Antibodies

Documents & Links for Anti ACP1 pAb (ATL-HPA016754)
Datasheet Anti ACP1 pAb (ATL-HPA016754) Datasheet (External Link)
Vendor Page Anti ACP1 pAb (ATL-HPA016754)