Anti ACOXL pAb (ATL-HPA035392)
Atlas Antibodies
- SKU:
- ATL-HPA035392-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ACOXL
Alternative Gene Name: FLJ11042
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027380: 77%, ENSRNOG00000016179: 74%
Entrez Gene ID: 55289
Uniprot ID: Q9NUZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | RSLVIGEVLSMADMATGVKCGIIYWLFGGAIRNLGSPEHVTKWFQPLQEQKYTGMFAMTERGHGSNARGIQTEATFDLSAQEFVIDTPCENAEKMY |
| Gene Sequence | RSLVIGEVLSMADMATGVKCGIIYWLFGGAIRNLGSPEHVTKWFQPLQEQKYTGMFAMTERGHGSNARGIQTEATFDLSAQEFVIDTPCENAEKMY |
| Gene ID - Mouse | ENSMUSG00000027380 |
| Gene ID - Rat | ENSRNOG00000016179 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACOXL pAb (ATL-HPA035392) | |
| Datasheet | Anti ACOXL pAb (ATL-HPA035392) Datasheet (External Link) |
| Vendor Page | Anti ACOXL pAb (ATL-HPA035392) at Atlas Antibodies |
| Documents & Links for Anti ACOXL pAb (ATL-HPA035392) | |
| Datasheet | Anti ACOXL pAb (ATL-HPA035392) Datasheet (External Link) |
| Vendor Page | Anti ACOXL pAb (ATL-HPA035392) |
| Citations for Anti ACOXL pAb (ATL-HPA035392) – 1 Found |
| O'Hurley, Gillian; Busch, Christer; Fagerberg, Linn; Hallström, Björn M; Stadler, Charlotte; Tolf, Anna; Lundberg, Emma; Schwenk, Jochen M; Jirström, Karin; Bjartell, Anders; Gallagher, William M; Uhlén, Mathias; Pontén, Fredrik. Analysis of the Human Prostate-Specific Proteome Defined by Transcriptomics and Antibody-Based Profiling Identifies TMEM79 and ACOXL as Two Putative, Diagnostic Markers in Prostate Cancer. Plos One. 10(8):e0133449. PubMed |