Anti ACOXL pAb (ATL-HPA035392)

Atlas Antibodies

Catalog No.: ATL-HPA035392-25

Protein Description: acyl-CoA oxidase-like
Gene Name: ACOXL
Alternative Gene Name: FLJ11042
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000027380: 77%, ENSRNOG00000016179: 74%
Entrez Gene ID: 55289
Uniprot ID: Q9NUZ1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RSLVIGEVLSMADMATGVKCGIIYWLFGGAIRNLGSPEHVTKWFQPLQEQKYTGMFAMTERGHGSNARGIQTEATFDLSAQEFVIDTPCENAEKMY
• Gene Sequence: RSLVIGEVLSMADMATGVKCGIIYWLFGGAIRNLGSPEHVTKWFQPLQEQKYTGMFAMTERGHGSNARGIQTEATFDLSAQEFVIDTPCENAEKMY
• Gene ID - Mouse: ENSMUSG00000027380
• Gene ID - Rat: ENSRNOG00000016179
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ACOXL pAb (ATL-HPA035392) – 1 Found

O'Hurley, Gillian; Busch, Christer; Fagerberg, Linn; Hallström, Björn M; Stadler, Charlotte; Tolf, Anna; Lundberg, Emma; Schwenk, Jochen M; Jirström, Karin; Bjartell, Anders; Gallagher, William M; Uhlén, Mathias; Pontén, Fredrik. Analysis of the Human Prostate-Specific Proteome Defined by Transcriptomics and Antibody-Based Profiling Identifies TMEM79 and ACOXL as Two Putative, Diagnostic Markers in Prostate Cancer. Plos One. 10(8):e0133449.