Anti ACOX3 pAb (ATL-HPA035840)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035840-25
- Shipping:
- Calculated at Checkout
$447.00
Gene Name: ACOX3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029098: 74%, ENSRNOG00000008474: 75%
Entrez Gene ID: 8310
Uniprot ID: O15254
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | YRGGYFSGEQAGEVLESAVLALCSQLKDDAVALVDVIAPPDFVLDSPIGRADGELYKNLWGAVLQESKVLERASWWPEFSVNKPVIGSLKSKL |
Gene Sequence | YRGGYFSGEQAGEVLESAVLALCSQLKDDAVALVDVIAPPDFVLDSPIGRADGELYKNLWGAVLQESKVLERASWWPEFSVNKPVIGSLKSKL |
Gene ID - Mouse | ENSMUSG00000029098 |
Gene ID - Rat | ENSRNOG00000008474 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACOX3 pAb (ATL-HPA035840) | |
Datasheet | Anti ACOX3 pAb (ATL-HPA035840) Datasheet (External Link) |
Vendor Page | Anti ACOX3 pAb (ATL-HPA035840) at Atlas Antibodies |
Documents & Links for Anti ACOX3 pAb (ATL-HPA035840) | |
Datasheet | Anti ACOX3 pAb (ATL-HPA035840) Datasheet (External Link) |
Vendor Page | Anti ACOX3 pAb (ATL-HPA035840) |
Citations for Anti ACOX3 pAb (ATL-HPA035840) – 3 Found |
Biase, Fernando H; Cao, Xiaoyi; Zhong, Sheng. Cell fate inclination within 2-cell and 4-cell mouse embryos revealed by single-cell RNA sequencing. Genome Research. 2014;24(11):1787-96. PubMed |
Valença, Isabel; Ferreira, Ana Rita; Correia, Marcelo; Kühl, Sandra; van Roermund, Carlo; Waterham, Hans R; Máximo, Valdemar; Islinger, Markus; Ribeiro, Daniela. Prostate Cancer Proliferation Is Affected by the Subcellular Localization of MCT2 and Accompanied by Significant Peroxisomal Alterations. Cancers. 2020;12(11) PubMed |
Alonso-Peña, Marta; Espinosa-Escudero, Ricardo; Herraez, Elisa; Briz, Oscar; Cagigal, Maria Luisa; Gonzalez-Santiago, Jesus M; Ortega-Alonso, Aida; Fernandez-Rodriguez, Conrado; Bujanda, Luis; Calvo Sanchez, Marta; D Avola, Delia; Londoño, Maria-Carlota; Diago, Moises; Fernandez-Checa, Jose C; Garcia-Ruiz, Carmen; Andrade, Raul J; Lammert, Frank; Prieto, Jesus; Crespo, Javier; Juamperez, Javier; Diaz-Gonzalez, Alvaro; Monte, Maria J; Marin, Jose J G. Beneficial effect of ursodeoxycholic acid in patients with acyl-CoA oxidase 2 (ACOX2) deficiency-associated hypertransaminasemia. Hepatology (Baltimore, Md.). 2022;76(5):1259-1274. PubMed |