Anti ACOX2 pAb (ATL-HPA038280 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA038280-25

• 
• 

Protein Description: acyl-CoA oxidase 2, branched chain
Gene Name: ACOX2
Alternative Gene Name: BRCACOX, BRCOX, THCCox
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021751: 65%, ENSRNOG00000007378: 73%
Entrez Gene ID: 8309
Uniprot ID: Q99424
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MGSPVHRVSLGDTWSRQMHPDIESERYMQSFDVERLTNILDGGAQNTALRRKVESIIHSYPEFSCKDNYFMTQN
• Gene Sequence: MGSPVHRVSLGDTWSRQMHPDIESERYMQSFDVERLTNILDGGAQNTALRRKVESIIHSYPEFSCKDNYFMTQN
• Gene ID - Mouse: ENSMUSG00000021751
• Gene ID - Rat: ENSRNOG00000007378
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti ACOX2 pAb (ATL-HPA038280 w/enhanced validation) – 2 Found

Vilarinho, Sílvia; Sari, Sinan; Mazzacuva, Francesca; Bilgüvar, Kaya; Esendagli-Yilmaz, Güldal; Jain, Dhanpat; Akyol, Gülen; Dalgiç, Buket; Günel, Murat; Clayton, Peter T; Lifton, Richard P. ACOX2 deficiency: A disorder of bile acid synthesis with transaminase elevation, liver fibrosis, ataxia, and cognitive impairment. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(40):11289-11293. 

Sui, Jane S Y; Martin, Petra; Keogh, Anna; Murchan, Pierre; Ryan, Lisa; Nicholson, Siobhan; Cuffe, Sinead; Broin, Pilib Ó; Finn, Stephen P; Fitzmaurice, Gerard J; Ryan, Ronan; Young, Vincent; Gray, Steven G. Altered expression of ACOX2 in non-small cell lung cancer. Bmc Pulmonary Medicine. 2022;22(1):321.