Anti ACOX2 pAb (ATL-HPA038280 w/enhanced validation)
Atlas Antibodies
- Catalog No.:
- ATL-HPA038280-25
- Shipping:
- Calculated at Checkout
$324.00
Gene Name: ACOX2
Alternative Gene Name: BRCACOX, BRCOX, THCCox
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000021751: 65%, ENSRNOG00000007378: 73%
Entrez Gene ID: 8309
Uniprot ID: Q99424
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | MGSPVHRVSLGDTWSRQMHPDIESERYMQSFDVERLTNILDGGAQNTALRRKVESIIHSYPEFSCKDNYFMTQN |
| Gene Sequence | MGSPVHRVSLGDTWSRQMHPDIESERYMQSFDVERLTNILDGGAQNTALRRKVESIIHSYPEFSCKDNYFMTQN |
| Gene ID - Mouse | ENSMUSG00000021751 |
| Gene ID - Rat | ENSRNOG00000007378 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACOX2 pAb (ATL-HPA038280 w/enhanced validation) | |
| Datasheet | Anti ACOX2 pAb (ATL-HPA038280 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACOX2 pAb (ATL-HPA038280 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti ACOX2 pAb (ATL-HPA038280 w/enhanced validation) | |
| Datasheet | Anti ACOX2 pAb (ATL-HPA038280 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti ACOX2 pAb (ATL-HPA038280 w/enhanced validation) |
| Citations for Anti ACOX2 pAb (ATL-HPA038280 w/enhanced validation) – 2 Found |
| Vilarinho, Sílvia; Sari, Sinan; Mazzacuva, Francesca; Bilgüvar, Kaya; Esendagli-Yilmaz, Güldal; Jain, Dhanpat; Akyol, Gülen; Dalgiç, Buket; Günel, Murat; Clayton, Peter T; Lifton, Richard P. ACOX2 deficiency: A disorder of bile acid synthesis with transaminase elevation, liver fibrosis, ataxia, and cognitive impairment. Proceedings Of The National Academy Of Sciences Of The United States Of America. 2016;113(40):11289-11293. PubMed |
| Sui, Jane S Y; Martin, Petra; Keogh, Anna; Murchan, Pierre; Ryan, Lisa; Nicholson, Siobhan; Cuffe, Sinead; Broin, Pilib Ó; Finn, Stephen P; Fitzmaurice, Gerard J; Ryan, Ronan; Young, Vincent; Gray, Steven G. Altered expression of ACOX2 in non-small cell lung cancer. Bmc Pulmonary Medicine. 2022;22(1):321. PubMed |