Anti ACOX1 pAb (ATL-HPA021195 w/enhanced validation)

Atlas Antibodies

Catalog No.:
ATL-HPA021195-25
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: acyl-CoA oxidase 1, palmitoyl
Gene Name: ACOX1
Alternative Gene Name: PALMCOX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020777: 88%, ENSRNOG00000008755: 90%
Entrez Gene ID: 51
Uniprot ID: Q15067
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGY
Gene Sequence AVRHQSEIKPGEPEPQILDFQTQQYKLFPLLATAYAFQFVGAYMKETYHRINEGIGQGDLSELPELHALTAGLKAFTSWTANTGIEACRMACGGHGY
Gene ID - Mouse ENSMUSG00000020777
Gene ID - Rat ENSRNOG00000008755
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACOX1 pAb (ATL-HPA021195 w/enhanced validation)
Datasheet Anti ACOX1 pAb (ATL-HPA021195 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACOX1 pAb (ATL-HPA021195 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti ACOX1 pAb (ATL-HPA021195 w/enhanced validation)
Datasheet Anti ACOX1 pAb (ATL-HPA021195 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACOX1 pAb (ATL-HPA021195 w/enhanced validation)
Citations for Anti ACOX1 pAb (ATL-HPA021195 w/enhanced validation) – 3 Found
Stadler, Charlotte; Rexhepaj, Elton; Singan, Vasanth R; Murphy, Robert F; Pepperkok, Rainer; Uhlén, Mathias; Simpson, Jeremy C; Lundberg, Emma. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nature Methods. 2013;10(4):315-23.  PubMed
Kanca, Oguz; Zirin, Jonathan; Garcia-Marques, Jorge; Knight, Shannon Marie; Yang-Zhou, Donghui; Amador, Gabriel; Chung, Hyunglok; Zuo, Zhongyuan; Ma, Liwen; He, Yuchun; Lin, Wen-Wen; Fang, Ying; Ge, Ming; Yamamoto, Shinya; Schulze, Karen L; Hu, Yanhui; Spradling, Allan C; Mohr, Stephanie E; Perrimon, Norbert; Bellen, Hugo J. An efficient CRISPR-based strategy to insert small and large fragments of DNA using short homology arms. Elife. 2019;8( 31674908)  PubMed
Chung, Hyung-Lok; Wangler, Michael F; Marcogliese, Paul C; Jo, Juyeon; Ravenscroft, Thomas A; Zuo, Zhongyuan; Duraine, Lita; Sadeghzadeh, Sina; Li-Kroeger, David; Schmidt, Robert E; Pestronk, Alan; Rosenfeld, Jill A; Burrage, Lindsay; Herndon, Mitchell J; Chen, Shan; Shillington, Amelle; Vawter-Lee, Marissa; Hopkin, Robert; Rodriguez-Smith, Jackeline; Henrickson, Michael; Lee, Brendan; Moser, Ann B; Jones, Richard O; Watkins, Paul; Yoo, Taekyeong; Mar, Soe; Choi, Murim; Bucelli, Robert C; Yamamoto, Shinya; Lee, Hyun Kyoung; Prada, Carlos E; Chae, Jong-Hee; Vogel, Tiphanie P; Bellen, Hugo J. Loss- or Gain-of-Function Mutations in ACOX1 Cause Axonal Loss via Different Mechanisms. Neuron. 2020;106(4):589-606.e6.  PubMed