Anti ACOX1 pAb (ATL-HPA021192)

Atlas Antibodies

SKU:
ATL-HPA021192-25
  • Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
  • Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm, plasma membrane & vesicles.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: acyl-CoA oxidase 1, palmitoyl
Gene Name: ACOX1
Alternative Gene Name: PALMCOX
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020777: 88%, ENSRNOG00000008755: 84%
Entrez Gene ID: 51
Uniprot ID: Q15067
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen MNPDLRRERDSASFNPELLTHILDGSPEKTRRRREIENMILNDPDFQHEDLNFLTRSQRYEVAVRKSAIMVKKMREFGIADPDEIMWFK
Gene Sequence MNPDLRRERDSASFNPELLTHILDGSPEKTRRRREIENMILNDPDFQHEDLNFLTRSQRYEVAVRKSAIMVKKMREFGIADPDEIMWFK
Gene ID - Mouse ENSMUSG00000020777
Gene ID - Rat ENSRNOG00000008755
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACOX1 pAb (ATL-HPA021192)
Datasheet Anti ACOX1 pAb (ATL-HPA021192) Datasheet (External Link)
Vendor Page Anti ACOX1 pAb (ATL-HPA021192) at Atlas Antibodies

Documents & Links for Anti ACOX1 pAb (ATL-HPA021192)
Datasheet Anti ACOX1 pAb (ATL-HPA021192) Datasheet (External Link)
Vendor Page Anti ACOX1 pAb (ATL-HPA021192)