Anti ACOT9 pAb (ATL-HPA035533)

Atlas Antibodies

SKU:
ATL-HPA035533-25
  • Immunohistochemical staining of human bronchus shows strong granular cytoplasmic positivity in respiratory epithelial cells.
  • Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoplasm, plasma membrane & cytosol.
  • Western blot analysis in human cell line RH-30.
Shipping:
Calculated at Checkout
$303.00
Adding to cart… The item has been added
Protein Description: acyl-CoA thioesterase 9
Gene Name: ACOT9
Alternative Gene Name: ACATE2, CGI-16, MT-ACT48
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025287: 82%, ENSRNOG00000003782: 80%
Entrez Gene ID: 23597
Uniprot ID: Q9Y305
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen VMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRVLPSNAVWME
Gene Sequence VMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRVLPSNAVWME
Gene ID - Mouse ENSMUSG00000025287
Gene ID - Rat ENSRNOG00000003782
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACOT9 pAb (ATL-HPA035533)
Datasheet Anti ACOT9 pAb (ATL-HPA035533) Datasheet (External Link)
Vendor Page Anti ACOT9 pAb (ATL-HPA035533) at Atlas Antibodies

Documents & Links for Anti ACOT9 pAb (ATL-HPA035533)
Datasheet Anti ACOT9 pAb (ATL-HPA035533) Datasheet (External Link)
Vendor Page Anti ACOT9 pAb (ATL-HPA035533)