Anti ACOT9 pAb (ATL-HPA035533)
Atlas Antibodies
- Catalog No.:
- ATL-HPA035533-25
- Shipping:
- Calculated at Checkout
$303.00
Gene Name: ACOT9
Alternative Gene Name: ACATE2, CGI-16, MT-ACT48
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000025287: 82%, ENSRNOG00000003782: 80%
Entrez Gene ID: 23597
Uniprot ID: Q9Y305
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | VMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRVLPSNAVWME |
Gene Sequence | VMVARDSENKGPAFVNPLIPESPEEEELFRQGELNKGRRIAFSSTSLLKMAPSAEERTTIHEMFLSTLDPKTISFRSRVLPSNAVWME |
Gene ID - Mouse | ENSMUSG00000025287 |
Gene ID - Rat | ENSRNOG00000003782 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACOT9 pAb (ATL-HPA035533) | |
Datasheet | Anti ACOT9 pAb (ATL-HPA035533) Datasheet (External Link) |
Vendor Page | Anti ACOT9 pAb (ATL-HPA035533) at Atlas Antibodies |
Documents & Links for Anti ACOT9 pAb (ATL-HPA035533) | |
Datasheet | Anti ACOT9 pAb (ATL-HPA035533) Datasheet (External Link) |
Vendor Page | Anti ACOT9 pAb (ATL-HPA035533) |