Anti ACOT6 pAb (ATL-HPA058258)
Atlas Antibodies
- Catalog No.:
- ATL-HPA058258-25
- Shipping:
- Calculated at Checkout
$478.00
Gene Name: ACOT6
Alternative Gene Name: C14orf42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043487: 65%, ENSRNOG00000029637: 72%
Entrez Gene ID: 641372
Uniprot ID: Q3I5F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | ATVLINACVANTVAPLHYKDMIIPKLVDDLGKVKITKSGFLTFMDTWSNPLEEHNHQSLVPLEKAQVPFLFIVGMDDQSWKSEFYAQI |
| Gene Sequence | ATVLINACVANTVAPLHYKDMIIPKLVDDLGKVKITKSGFLTFMDTWSNPLEEHNHQSLVPLEKAQVPFLFIVGMDDQSWKSEFYAQI |
| Gene ID - Mouse | ENSMUSG00000043487 |
| Gene ID - Rat | ENSRNOG00000029637 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACOT6 pAb (ATL-HPA058258) | |
| Datasheet | Anti ACOT6 pAb (ATL-HPA058258) Datasheet (External Link) |
| Vendor Page | Anti ACOT6 pAb (ATL-HPA058258) at Atlas Antibodies |
| Documents & Links for Anti ACOT6 pAb (ATL-HPA058258) | |
| Datasheet | Anti ACOT6 pAb (ATL-HPA058258) Datasheet (External Link) |
| Vendor Page | Anti ACOT6 pAb (ATL-HPA058258) |