Anti ACOT6 pAb (ATL-HPA058258)

Atlas Antibodies

Catalog No.:
ATL-HPA058258-25
Shipping:
Calculated at Checkout
$478.00
Adding to cart… The item has been added
Protein Description: acyl-CoA thioesterase 6
Gene Name: ACOT6
Alternative Gene Name: C14orf42
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043487: 65%, ENSRNOG00000029637: 72%
Entrez Gene ID: 641372
Uniprot ID: Q3I5F7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ATVLINACVANTVAPLHYKDMIIPKLVDDLGKVKITKSGFLTFMDTWSNPLEEHNHQSLVPLEKAQVPFLFIVGMDDQSWKSEFYAQI
Gene Sequence ATVLINACVANTVAPLHYKDMIIPKLVDDLGKVKITKSGFLTFMDTWSNPLEEHNHQSLVPLEKAQVPFLFIVGMDDQSWKSEFYAQI
Gene ID - Mouse ENSMUSG00000043487
Gene ID - Rat ENSRNOG00000029637
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACOT6 pAb (ATL-HPA058258)
Datasheet Anti ACOT6 pAb (ATL-HPA058258) Datasheet (External Link)
Vendor Page Anti ACOT6 pAb (ATL-HPA058258) at Atlas Antibodies

Documents & Links for Anti ACOT6 pAb (ATL-HPA058258)
Datasheet Anti ACOT6 pAb (ATL-HPA058258) Datasheet (External Link)
Vendor Page Anti ACOT6 pAb (ATL-HPA058258)