Anti ACOT4 pAb (ATL-HPA000779)

Atlas Antibodies

SKU:
ATL-HPA000779-25
  • Immunohistochemical staining of human liver shows strong granular cytoplasmic positivity in hepatocytes.
  • Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line EFO-21
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: acyl-CoA thioesterase 4
Gene Name: ACOT4
Alternative Gene Name: FLJ31235, PTE-Ib, PTE2B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000052392: 75%, ENSRNOG00000046864: 77%
Entrez Gene ID: 122970
Uniprot ID: Q8N9L9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PPLGYDLRRIKVAFSGLVDIVDIRNALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKPQIICYPGTGHYIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKT
Gene Sequence PPLGYDLRRIKVAFSGLVDIVDIRNALVGGYKNPSMIPIEKAQGPILLIVGQDDHNWRSELYAQTVSERLQAHGKEKPQIICYPGTGHYIEPPYFPLCPASLHRLLNKHVIWGGEPRAHSKAQEDAWKQILAFFCKHLGGTQKT
Gene ID - Mouse ENSMUSG00000052392
Gene ID - Rat ENSRNOG00000046864
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.


Documents & Links for Anti ACOT4 pAb (ATL-HPA000779)
Datasheet Anti ACOT4 pAb (ATL-HPA000779) Datasheet (External Link)
Vendor Page Anti ACOT4 pAb (ATL-HPA000779) at Atlas Antibodies

Documents & Links for Anti ACOT4 pAb (ATL-HPA000779)
Datasheet Anti ACOT4 pAb (ATL-HPA000779) Datasheet (External Link)
Vendor Page Anti ACOT4 pAb (ATL-HPA000779)