Anti ACOT13 pAb (ATL-HPA019881)

Atlas Antibodies

Catalog No.:
ATL-HPA019881-100
Shipping:
Calculated at Checkout
$638.00
Adding to cart… The item has been added
Protein Description: acyl-CoA thioesterase 13
Gene Name: ACOT13
Alternative Gene Name: HT012, THEM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006717: 92%, ENSRNOG00000018415: 90%
Entrez Gene ID: 55856
Uniprot ID: Q9NPJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human, Mouse, Rat
Clonality Polyclonal
Host Rabbit
Immunogen GAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN
Gene Sequence GAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN
Gene ID - Mouse ENSMUSG00000006717
Gene ID - Rat ENSRNOG00000018415
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links for Anti ACOT13 pAb (ATL-HPA019881)
Datasheet Anti ACOT13 pAb (ATL-HPA019881) Datasheet (External Link)
Vendor Page Anti ACOT13 pAb (ATL-HPA019881) at Atlas Antibodies

Documents & Links for Anti ACOT13 pAb (ATL-HPA019881)
Datasheet Anti ACOT13 pAb (ATL-HPA019881) Datasheet (External Link)
Vendor Page Anti ACOT13 pAb (ATL-HPA019881)