Anti ACOT13 pAb (ATL-HPA019881)
Atlas Antibodies
- Catalog No.:
- ATL-HPA019881-100
- Shipping:
- Calculated at Checkout
$638.00
Gene Name: ACOT13
Alternative Gene Name: HT012, THEM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006717: 92%, ENSRNOG00000018415: 90%
Entrez Gene ID: 55856
Uniprot ID: Q9NPJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, ICC, IHC |
| Reactivity | Human, Mouse, Rat |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | GAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN |
| Gene Sequence | GAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN |
| Gene ID - Mouse | ENSMUSG00000006717 |
| Gene ID - Rat | ENSRNOG00000018415 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti ACOT13 pAb (ATL-HPA019881) | |
| Datasheet | Anti ACOT13 pAb (ATL-HPA019881) Datasheet (External Link) |
| Vendor Page | Anti ACOT13 pAb (ATL-HPA019881) at Atlas Antibodies |
| Documents & Links for Anti ACOT13 pAb (ATL-HPA019881) | |
| Datasheet | Anti ACOT13 pAb (ATL-HPA019881) Datasheet (External Link) |
| Vendor Page | Anti ACOT13 pAb (ATL-HPA019881) |