Anti ACOT13 pAb (ATL-HPA019881)

Atlas Antibodies

SKU: ATL-HPA019881-100

• 
• 
• 

Protein Description: acyl-CoA thioesterase 13
Gene Name: ACOT13
Alternative Gene Name: HT012, THEM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006717: 92%, ENSRNOG00000018415: 90%
Entrez Gene ID: 55856
Uniprot ID: Q9NPJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN
• Gene Sequence: GAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN
• Gene ID - Mouse: ENSMUSG00000006717
• Gene ID - Rat: ENSRNOG00000018415
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.