Anti ACOT13 pAb (ATL-HPA019881)
Atlas Antibodies
- SKU:
- ATL-HPA019881-100
- Shipping:
- Calculated at Checkout
$596.00
Gene Name: ACOT13
Alternative Gene Name: HT012, THEM2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000006717: 92%, ENSRNOG00000018415: 90%
Entrez Gene ID: 55856
Uniprot ID: Q9NPJ3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | WB, ICC, IHC |
Reactivity | Human, Mouse, Rat |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN |
Gene Sequence | GAPGVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIAQGRHTKHLGN |
Gene ID - Mouse | ENSMUSG00000006717 |
Gene ID - Rat | ENSRNOG00000018415 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links for Anti ACOT13 pAb (ATL-HPA019881) | |
Datasheet | Anti ACOT13 pAb (ATL-HPA019881) Datasheet (External Link) |
Vendor Page | Anti ACOT13 pAb (ATL-HPA019881) at Atlas Antibodies |
Documents & Links for Anti ACOT13 pAb (ATL-HPA019881) | |
Datasheet | Anti ACOT13 pAb (ATL-HPA019881) Datasheet (External Link) |
Vendor Page | Anti ACOT13 pAb (ATL-HPA019881) |