Anti ACOT11 pAb (ATL-HPA041047 w/enhanced validation)

Atlas Antibodies

SKU:
ATL-HPA041047-25
  • Immunohistochemistry analysis in human duodenum and pancreas tissues using Anti-ACOT11 antibody. Corresponding ACOT11 RNA-seq data are presented for the same tissues.
  • Immunofluorescent staining of human cell line A-431 shows localization to cytosol.
  • Western blot analysis in human cell line RT-4.
Shipping:
Calculated at Checkout
$447.00
Adding to cart… The item has been added
Protein Description: acyl-CoA thioesterase 11
Gene Name: ACOT11
Alternative Gene Name: BFIT, BFIT1, KIAA0707, STARD14, THEA, THEM1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034853: 92%, ENSRNOG00000007837: 89%
Entrez Gene ID: 26027
Uniprot ID: Q8WXI4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application WB, ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen FLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRGE
Gene Sequence FLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRGE
Gene ID - Mouse ENSMUSG00000034853
Gene ID - Rat ENSRNOG00000007837
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.



Documents & Links for Anti ACOT11 pAb (ATL-HPA041047 w/enhanced validation)
Datasheet Anti ACOT11 pAb (ATL-HPA041047 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti ACOT11 pAb (ATL-HPA041047 w/enhanced validation)